DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Krn and grk

DIOPT Version :9

Sequence 1:NP_524129.1 Gene:Krn / 326198 FlyBaseID:FBgn0052179 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_476568.2 Gene:grk / 34171 FlyBaseID:FBgn0001137 Length:295 Species:Drosophila melanogaster


Alignment Length:161 Identity:49/161 - (30%)
Similarity:71/161 - (44%) Gaps:34/161 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PLTAACSSRAIAKPRP---TAAPILPPD----NVEISTTPRPN---VTFPIFACPPTYVAWYCLN 73
            |:|   .|..:..|..   |..|  |||    :...||||.||   ....:..|...|...:|||
  Fly   135 PIT---DSETVTTPETVTHTGEP--PPDPSSSSTPDSTTPSPNDKETEIQMLPCSEAYNTSFCLN 194

  Fly    74 DGTCFT-VKIHNEILYNCECALGFMGPRCEYKEIDGSYL---PTRNRVMLEKASIVSG------- 127
            .|.||. ..::|.:.::|.|...:.|.||.||..:|.|:   ||..| .:..|.||..       
  Fly   195 GGHCFQHPMVNNTVFHSCLCVNDYDGERCAYKSWNGDYIYSPPTAQR-KVRMAHIVFSFPVLLML 258

  Fly   128 ATLALLFMAMCCVVLYLRH---EKLQKQKLH 155
            ::|.:||.|    |..||:   .:.::|:||
  Fly   259 SSLYVLFAA----VFMLRNVPDYRRKQQQLH 285



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443727
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009987
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12332
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.