DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Krn and dlc

DIOPT Version :9

Sequence 1:NP_524129.1 Gene:Krn / 326198 FlyBaseID:FBgn0052179 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_571019.1 Gene:dlc / 30120 ZFINID:ZDB-GENE-000125-4 Length:664 Species:Danio rerio


Alignment Length:166 Identity:41/166 - (24%)
Similarity:75/166 - (45%) Gaps:43/166 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 CLNDGTCFTVKIHNEILYNCECALGFMGPRCEYKE----IDGSYLPTRNRVMLEKASIVSGATLA 131
            |.|.|||:| .....:   |:|..||||.:||||:    ::...||         |:::...||.
Zfish   467 CQNGGTCYT-HFSGPV---CQCPAGFMGTQCEYKQKPTPVNSPALP---------AALIVSFTLG 518

  Fly   132 L--LFMAMCCVVLYLRHEKLQKQKLHDSTTTTTTDGGCQNEGMDEVD---GLRPLRPVRR----- 186
            |  |.:.:|..::.||    |.::.|.:::||.      ...:|.|:   .|.|..|:.|     
Zfish   519 LITLTLVICAAIVVLR----QMRQNHKASSTTV------RNNLDSVNNRISLSPTSPLGREKEAF 573

  Fly   187 --PFGPCRI----LSLEEAHLQAKASNRPRHCNELL 216
              |.||.::    ::|....:...:|::..:..:::
Zfish   574 LIPGGPFKVSNKDMALRSTSVDTHSSDKSNYKQKMV 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrnNP_524129.1 None
dlcNP_571019.1 MNNL 21..79 CDD:284966
DSL 136..198 CDD:279722
EGF_CA 265..303 CDD:238011
EGF_CA 307..341 CDD:238011
EGF_CA <350..380 CDD:238011
EGF_CA 383..418 CDD:238011
EGF_CA 420..455 CDD:238011
EGF_CA <466..494 CDD:238011 12/30 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.