DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Krn and Epgn

DIOPT Version :9

Sequence 1:NP_524129.1 Gene:Krn / 326198 FlyBaseID:FBgn0052179 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001292099.1 Gene:Epgn / 289515 RGDID:1560084 Length:182 Species:Rattus norvegicus


Alignment Length:197 Identity:46/197 - (23%)
Similarity:69/197 - (35%) Gaps:61/197 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QDLLL---LATALIGAYLPLTAACSSRAIAKPRPTAAPILPPDNVEISTTPRP-----NVTFPIF 60
            ||:.|   :|..|:  :..:.||.|....|         :||     |||.:.     |:|...:
  Rat    28 QDMALRVPIAVCLL--FKAMKAALSEETEA---------VPP-----STTTQQSDWTLNITEADY 76

  Fly    61 ACPPTYVAW----------YCLNDGTCFTVKIHNEILYNCECALGFMGPRCEYKEIDGSYLPTRN 115
            ...|..:.:          ||:|....|..::...|   |.|..|:.|.|||:..:      |..
  Rat    77 IEEPVALKFSHPCLEDHNSYCINGACAFHHELKKAI---CRCFTGYTGERCEHLTL------TSY 132

  Fly   116 RVMLEKASIVSGATLALLFMAMCCV-VLYLRHEKLQKQKLHDSTTTTTTDGGCQNEGMDEVDGLR 179
            .|...:..|..|..:.||..|...| ..|:|     |:.|:..:......||            |
  Rat   133 AVDSYEKYIAIGIGVGLLISAFLAVFYCYVR-----KRCLNVKSPYIICSGG------------R 180

  Fly   180 PL 181
            ||
  Rat   181 PL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrnNP_524129.1 None
EpgnNP_001292099.1 PHA02887 <84..129 CDD:165214 12/47 (26%)
DUF4514 <139..171 CDD:291647 10/36 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.