DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Krn and EPGN

DIOPT Version :9

Sequence 1:NP_524129.1 Gene:Krn / 326198 FlyBaseID:FBgn0052179 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001257918.1 Gene:EPGN / 255324 HGNCID:17470 Length:154 Species:Homo sapiens


Alignment Length:98 Identity:26/98 - (26%)
Similarity:38/98 - (38%) Gaps:15/98 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IGAYL---PLTAACSSRAIAKPRPTAAPILPPDNVEISTTPRPNVTFPI-----FACPPTYVAWY 70
            |..||   .:||.....|:....|..|   ...|..::.|...|:..||     ..|...:.: |
Human     7 ISVYLLFNAMTALTEEAAVTVTPPITA---QQGNWTVNKTEADNIEGPIALKFSHLCLEDHNS-Y 67

  Fly    71 CLNDGTCFTVKIHNEILYNCECALGFMGPRCEY 103
            |:|....|..::...|   |.|..|:.|.|||:
Human    68 CINGACAFHHELEKAI---CRCFTGYTGERCEH 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrnNP_524129.1 None
EPGNNP_001257918.1 PHA02887 <60..100 CDD:165214 13/42 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.