DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Krn and Tgfa

DIOPT Version :9

Sequence 1:NP_524129.1 Gene:Krn / 326198 FlyBaseID:FBgn0052179 Length:217 Species:Drosophila melanogaster
Sequence 2:XP_038962998.1 Gene:Tgfa / 24827 RGDID:3849 Length:161 Species:Rattus norvegicus


Alignment Length:165 Identity:43/165 - (26%)
Similarity:65/165 - (39%) Gaps:46/165 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AQDLLLLATALIGAYLPLTAAC-----SSRAIAKPRPTAAPILPPDNVEISTTPRPNVTFPIFAC 62
            |..|.|||..:      |.|.|     |:..::...|.||.::...|                .|
  Rat     5 AGQLALLALGI------LVAVCQALENSTSPLSADSPVAAAVVSHFN----------------KC 47

  Fly    63 PPTYVAWYCLNDGTC-FTVKIHNEILYNCECALGFMGPRCEYKEIDGSYLPTRNRVMLEKASIVS 126
            |.::.. ||.: ||| |.|:   |....|.|..|::|.|||:.::......::.:..:....:||
  Rat    48 PDSHTQ-YCFH-GTCRFLVQ---EEKPACVCHSGYVGVRCEHADLLAVVAASQKKQAITALVVVS 107

  Fly   127 GATLALLFMAM----CCVV---------LYLRHEK 148
            ...||:|.:..    ||.|         |..||||
  Rat   108 IVALAVLIITCVLIHCCQVRKHCEWCRALVCRHEK 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrnNP_524129.1 None
TgfaXP_038962998.1 PHA02887 <44..83 CDD:165214 16/59 (27%)
PHA03099 <47..121 CDD:165381 22/78 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.