DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Krn and AgaP_AGAP010312

DIOPT Version :9

Sequence 1:NP_524129.1 Gene:Krn / 326198 FlyBaseID:FBgn0052179 Length:217 Species:Drosophila melanogaster
Sequence 2:XP_319506.4 Gene:AgaP_AGAP010312 / 1279733 VectorBaseID:AGAP010312 Length:127 Species:Anopheles gambiae


Alignment Length:75 Identity:42/75 - (56%)
Similarity:47/75 - (62%) Gaps:12/75 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YLPLTAACSSRAIAKPRPTAAPILPPDNVEISTTPRPNVTFPIFACPPTYVAWYCLNDGTCFTVK 81
            |.|:|.|||||...||||.            |.|.|||:||..:.|||.|.|||||||.||||||
Mosquito    65 YFPMTDACSSRTTPKPRPP------------SPTNRPNITFHTYKCPPAYAAWYCLNDATCFTVK 117

  Fly    82 IHNEILYNCE 91
            |.:.:|||||
Mosquito   118 IGDSLLYNCE 127



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009987
OrthoInspector 1 1.000 - - otm49902
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X13533
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.