DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Krn and Btc

DIOPT Version :9

Sequence 1:NP_524129.1 Gene:Krn / 326198 FlyBaseID:FBgn0052179 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_031594.1 Gene:Btc / 12223 MGIID:99439 Length:177 Species:Mus musculus


Alignment Length:171 Identity:49/171 - (28%)
Similarity:66/171 - (38%) Gaps:11/171 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLATALIGAYLPLTAACSSRAIAKPRPTAAPILPPDNVEISTTPRPNVTFPIFACPPTYVAWYC 71
            |||..||..|.|....| .......|....:....|......||||..|......||..| ..||
Mouse    15 LLLVLALGLAILHCVVA-DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQY-KHYC 77

  Fly    72 LNDGTC-FTVKIHNEILYNCECALGFMGPRCEYKEIDGSYLPTRNRVMLEKASIVSGATLALLFM 135
            :: |.| |.|   :|...:|.|..|:.|.|||  .:|..||......:|....||......:|.:
Mouse    78 IH-GRCRFVV---DEQTPSCICEKGYFGARCE--RVDLFYLQQDRGQILVVCLIVVMVVFIILVI 136

  Fly   136 AMCCVVLYLRHEKLQKQKLHDSTTTTTTDGGCQNEGMDEVD 176
            .:|.....||  |.:|:|..:...|...|....:|.:.|.:
Mouse   137 GVCTCCHPLR--KHRKKKKEEKMETLDKDKTPISEDIQETN 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrnNP_524129.1 None
BtcNP_031594.1 PHA02887 <51..109 CDD:165214 22/64 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.