DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Krn and Btc

DIOPT Version :10

Sequence 1:NP_524129.1 Gene:Krn / 326198 FlyBaseID:FBgn0052179 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_031594.1 Gene:Btc / 12223 MGIID:99439 Length:177 Species:Mus musculus


Alignment Length:171 Identity:49/171 - (28%)
Similarity:66/171 - (38%) Gaps:11/171 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLATALIGAYLPLTAACSSRAIAKPRPTAAPILPPDNVEISTTPRPNVTFPIFACPPTYVAWYC 71
            |||..||..|.|....| .......|....:....|......||||..|......||..| ..||
Mouse    15 LLLVLALGLAILHCVVA-DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQY-KHYC 77

  Fly    72 LNDGTC-FTVKIHNEILYNCECALGFMGPRCEYKEIDGSYLPTRNRVMLEKASIVSGATLALLFM 135
            :: |.| |.|   :|...:|.|..|:.|.|||  .:|..||......:|....||......:|.:
Mouse    78 IH-GRCRFVV---DEQTPSCICEKGYFGARCE--RVDLFYLQQDRGQILVVCLIVVMVVFIILVI 136

  Fly   136 AMCCVVLYLRHEKLQKQKLHDSTTTTTTDGGCQNEGMDEVD 176
            .:|.....||  |.:|:|..:...|...|....:|.:.|.:
Mouse   137 GVCTCCHPLR--KHRKKKKEEKMETLDKDKTPISEDIQETN 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrnNP_524129.1 None
BtcNP_031594.1 PHA02887 <51..109 CDD:165214 22/64 (34%)

Return to query results.
Submit another query.