DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Krn and Areg

DIOPT Version :9

Sequence 1:NP_524129.1 Gene:Krn / 326198 FlyBaseID:FBgn0052179 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_033834.1 Gene:Areg / 11839 MGIID:88068 Length:248 Species:Mus musculus


Alignment Length:99 Identity:23/99 - (23%)
Similarity:39/99 - (39%) Gaps:23/99 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 IHNEILY-------NCECALGFMGPRCEYKEI-----DGSYLPTRNRVMLEKASI-VSGATLALL 133
            ||.|..|       .|.|...:.|.||..|.:     |...|   :::.:...:| ||...||.:
Mouse   148 IHGECRYIENLEVVTCNCHQDYFGERCGEKSMKTHSEDDKDL---SKIAVVAVTIFVSAIILAAI 209

  Fly   134 FMAMCCVV-LYLRH------EKLQKQKLHDSTTT 160
            .:.:...| |:.|:      |..::::|.....|
Mouse   210 GIGIVITVHLWKRYFREYEGETEERRRLRQENGT 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrnNP_524129.1 None
AregNP_033834.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..48
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 57..77
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..136
PHA02887 <139..179 CDD:165214 10/30 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.