DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Krn and AgaP_AGAP012986

DIOPT Version :9

Sequence 1:NP_524129.1 Gene:Krn / 326198 FlyBaseID:FBgn0052179 Length:217 Species:Drosophila melanogaster
Sequence 2:XP_003437057.1 Gene:AgaP_AGAP012986 / 11175853 VectorBaseID:AGAP012986 Length:243 Species:Anopheles gambiae


Alignment Length:84 Identity:37/84 - (44%)
Similarity:48/84 - (57%) Gaps:3/84 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CPPTYVAWYCLNDGTCFTVKIHNEILYNCECALGFMGPRCEYKEIDGSYLPTRN-RVMLEKASIV 125
            |...:...||||.|.|:...|.|..:..||||.||||.|||.|.:||:||..|. ::.:|.||:.
Mosquito   155 CSQLFEENYCLNGGKCYNFTIANSTMPTCECADGFMGERCESKYLDGTYLSMRKPKIHIETASMY 219

  Fly   126 SGATLALLFMAMCCVVLYL 144
            .||.||:  |.:..|..||
Mosquito   220 YGAFLAM--MVVLAVFYYL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrnNP_524129.1 None
AgaP_AGAP012986XP_003437057.1 EGF_CA 160..195 CDD:238011 17/34 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I7314
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009987
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12332
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.