DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Krn and MSANTD3-TMEFF1

DIOPT Version :9

Sequence 1:NP_524129.1 Gene:Krn / 326198 FlyBaseID:FBgn0052179 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001185741.1 Gene:MSANTD3-TMEFF1 / 100526694 HGNCID:38838 Length:454 Species:Homo sapiens


Alignment Length:114 Identity:28/114 - (24%)
Similarity:51/114 - (44%) Gaps:23/114 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CPPTYVAWYCLNDGTCFTVKIHNEILY-----NCECALGFMGPRCEYKEIDGSY-LPTRNR---V 117
            ||.. :..||:: |.|       |.:|     :|.|..|:.|..||..:....| :|:|.:   |
Human   349 CPEN-LNGYCIH-GKC-------EFIYSTQKASCRCESGYTGQHCEKTDFSILYVVPSRQKLTHV 404

  Fly   118 MLEKASIVSGATLALLFMAMCCVVLYL---RHEKLQKQKLHDSTTTTTT 163
            ::  |:|:....:|::...:.|:....   ...:.|||.|...|:.|::
Human   405 LI--AAIIGAVQIAIIVAIVMCITRKCPKNNRGRRQKQNLGHFTSDTSS 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrnNP_524129.1 None
MSANTD3-TMEFF1NP_001185741.1 Myb_DNA-bind_5 9..83 CDD:290584
KAZAL 173..217 CDD:197624
KAZAL 263..309 CDD:197624
PHA02887 <349..385 CDD:165214 12/44 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.