DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Krn and btc

DIOPT Version :9

Sequence 1:NP_524129.1 Gene:Krn / 326198 FlyBaseID:FBgn0052179 Length:217 Species:Drosophila melanogaster
Sequence 2:XP_002941813.1 Gene:btc / 100497610 XenbaseID:XB-GENE-995923 Length:170 Species:Xenopus tropicalis


Alignment Length:172 Identity:47/172 - (27%)
Similarity:71/172 - (41%) Gaps:18/172 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLATALIGAYLPLTAACSSRAIAKPRPTAAPI--LPPDNVEISTTPRPNVTFPIFACPPTYVAW 69
            |||...|....||..:. ...:...|..|:.|.  ...|..|:|:..:.|..|.  .||.|| ..
 Frog    10 LLLPLFLGFTVLPYVST-DGNSTEHPETTSPPCPQYTDDCTELSSQSKWNGHFS--RCPRTY-RH 70

  Fly    70 YCLNDGTCFTVKIHNEILYNCECALGFMGPRCEYKEIDGSYLPTRNRVMLEKASIVSGATLALLF 134
            ||:. |.|..|..  |.:..|.|.||:.|.||||  :|..||....|..:....||:...|.:|.
 Frog    71 YCIK-GKCRFVTA--ESIPACICDLGYTGARCEY--LDLFYLKGDRRHYVVIGLIVAMMFLIILI 130

  Fly   135 MAMCCVVLYLRHEKLQKQKLHDSTTTTTTDGGCQNEGMDEVD 176
            :.:|....:.:..:.:|:|..:..       |..|:...:|:
 Frog   131 VGICICTHHWQRAQRRKRKEKERE-------GLNNDSATKVE 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrnNP_524129.1 None
btcXP_002941813.1 PHA02887 <61..100 CDD:165214 17/44 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.