DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Krn and nrg2b

DIOPT Version :9

Sequence 1:NP_524129.1 Gene:Krn / 326198 FlyBaseID:FBgn0052179 Length:217 Species:Drosophila melanogaster
Sequence 2:XP_005157176.1 Gene:nrg2b / 100270726 ZFINID:ZDB-GENE-090205-2 Length:705 Species:Danio rerio


Alignment Length:93 Identity:25/93 - (26%)
Similarity:50/93 - (53%) Gaps:9/93 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 YCLNDGTCFTVKIHNEILYNCECALGFMGPRCEYKEIDGSY------LPTRNRVMLEKASIVSGA 128
            ||:|.|.|:.:...|::  :|:|...:.|.||:...:.|.|      :.....:..::...::|.
Zfish   253 YCINGGDCYFIHGINQL--SCKCPNDYTGERCQTSVMAGFYKHLGIEIMEAEELYQKRVLTITGI 315

  Fly   129 TLALLFMAMCCVVLYLRHEKLQKQKLHD 156
            .:|||.:.:.|||.|.:.:| |::|:|:
Zfish   316 CVALLVVGIVCVVAYCKTKK-QRKKMHN 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrnNP_524129.1 None
nrg2bXP_005157176.1 I-set 143..229 CDD:254352
Ig 157..227 CDD:299845
PHA02887 <192..283 CDD:165214 10/31 (32%)
Neuregulin 301..690 CDD:280343 12/43 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.