DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Krn and egf

DIOPT Version :9

Sequence 1:NP_524129.1 Gene:Krn / 326198 FlyBaseID:FBgn0052179 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001106478.1 Gene:egf / 100127663 XenbaseID:XB-GENE-951823 Length:1051 Species:Xenopus tropicalis


Alignment Length:116 Identity:31/116 - (26%)
Similarity:51/116 - (43%) Gaps:11/116 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CPPTYVAWYCLNDGTCFTVKIHNEIL--YNCECALGFMGPRCEYKEIDGSYLPTRNRVMLEKASI 124
            ||..|.. ||||.|.|    ||...|  |.|.|..|::|.||::.::. |:.....::.:...:|
 Frog   930 CPLAYDG-YCLNGGVC----IHFPELKDYGCRCVAGYVGERCQFDDLK-SWEKHVTQMKIHNVTI 988

  Fly   125 VSGATLALLFMAMCCVVLYLRHEKLQKQKLH---DSTTTTTTDGGCQNEGM 172
            .....|.||.:.:....:|....::..:|.|   ::...||....|...|:
 Frog   989 AVSLLLLLLILGLGSFAIYYYRHQMTHRKNHFKQETAPGTTEKPICSTSGL 1039

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrnNP_524129.1 None
egfNP_001106478.1 LY 152..194 CDD:214531
vWFA <346..398 CDD:320736
FXa_inhibition 412..440 CDD:317114
FXa_inhibition 447..480 CDD:317114
LY 508..550 CDD:214531
LY 554..593 CDD:214531
Ldl_recept_b 615..654 CDD:278487
LY 638..680 CDD:214531
EGF_3 810..838 CDD:315598
EGF_3 851..880 CDD:315598
EGF_3 886..>914 CDD:315598
PHA02887 <927..>967 CDD:333467 18/41 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.