DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Krn and Nrg2

DIOPT Version :9

Sequence 1:	NP_524129.1	Gene:	Krn / 326198	FlyBaseID:	FBgn0052179	Length:	217	Species:	Drosophila melanogaster
Sequence 2:	NP_001369349.1	Gene:	Nrg2 / 100042150	MGIID:	1098246	Length:	859	Species:	Mus musculus

Alignment Length:	100	Identity:	29/100 - (28%)
Similarity:	51/100 - (51%)	Gaps:	24/100 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly    70 YCLNDGTCFTVKIHNEILYNCECALGFMGPRC--------------EYKEIDGSYLPTRNRVMLE 120
            ||:|.|.|:.::..|::  :|:|.:|:.|.||              |.||.:..|   :.||:
Mouse   363 YCVNGGVCYYIEGINQL--SCKCPVGYTGDRCQQFAMVNFSKHLGFELKEAEELY---QKRVL-- 420

  Fly   121 KASIVSGATLALLFMAMCCVVLYLRHEKLQKQKLH 155
               .::|..:|||.:.:.|||.|.:.:|.::|..|
Mouse   421 ---TITGICVALLVVGIVCVVAYCKTKKQRRQMHH 452

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Krn	NP_524129.1	None
Nrg2	NP_001369349.1	Ig_Pro_neuregulin	248..339	CDD:409408
		Ig strand B	264..268	CDD:409408
		Ig strand C	278..282	CDD:409408
		Ig strand E	305..309	CDD:409408
		Ig strand F	319..324	CDD:409408
		Ig strand G	332..335	CDD:409408
		PHA02887	<354..397	CDD:165214	12/35 (34%)
		Neuregulin	443..840	CDD:396641	2/9 (22%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910