DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Krn and nrg2a

DIOPT Version :9

Sequence 1:NP_524129.1 Gene:Krn / 326198 FlyBaseID:FBgn0052179 Length:217 Species:Drosophila melanogaster
Sequence 2:XP_005161385.1 Gene:nrg2a / 100006951 ZFINID:ZDB-GENE-070615-10 Length:710 Species:Danio rerio


Alignment Length:101 Identity:28/101 - (27%)
Similarity:51/101 - (50%) Gaps:25/101 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 YCLNDGTCFTVKIHNEILYNCECALGFMGPRC--------------EYKEIDGSYLPTRNRVMLE 120
            ||:|.|.|:.:...|::  :|:|...:.|.||              |:.|.:..|   :.||:  
Zfish   254 YCVNGGDCYYIHGINQL--SCKCPNDYTGDRCQTSVMASFYQSLGIEFMEAEELY---QKRVL-- 311

  Fly   121 KASIVSGATLALLFMAMCCVVLYLRHEKLQKQKLHD 156
               .::|..:|||.:.:.|||.|.:.:| |::|:|:
Zfish   312 ---TITGICVALLVVGIVCVVAYCKTKK-QRKKMHN 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrnNP_524129.1 None
nrg2aXP_005161385.1 IG_like 149..230 CDD:214653
Ig_Pro_neuregulin 158..228 CDD:143227
PHA03099 220..341 CDD:165381 26/97 (27%)
Neuregulin 302..698 CDD:280343 15/51 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.