DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ndfip and NDFIP1

DIOPT Version :9

Sequence 1:NP_730291.1 Gene:Ndfip / 326197 FlyBaseID:FBgn0052177 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_085048.1 Gene:NDFIP1 / 80762 HGNCID:17592 Length:221 Species:Homo sapiens


Alignment Length:267 Identity:75/267 - (28%)
Similarity:109/267 - (40%) Gaps:73/267 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NQPSPGDDQLGPPKADFSAPPPYEANVGHGQQVALPAQMPPLALATPDPSQIPIQMQVQLPSQAD 69
            |:...|:    |.:|...|||||.                  :::....:....:.:...|.   
Human    24 NEEESGE----PEQAAGDAPPPYS------------------SISAESAAYFDYKDESGFPK--- 63

  Fly    70 LMNAQLPP--EIHGKLPTYEEVQMEKSLNGELPPAFLTLPSSQQLPPPPNPLLPPNPLRDGAAAV 132
                  ||  .:...||:|:|.:..|        |..|:|            |.|....|     
Human    64 ------PPSYNVATTLPSYDEAERTK--------AEATIP------------LVPGRDED----- 97

  Fly   133 RSAQPALTFIAIDASDPENSLSTTDNLLGTDIMFITAFIVAFLFNWIGFLMLTCFCHTIAARYGA 197
                    |:..|..|..:.|.     :|.|.:|:..|.:|||||||||.:..|...:.|.||||
Human    98 --------FVGRDDFDDADQLR-----IGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRYGA 149

  Fly   198 LSGFGLSLAKWTLIVKHSTDLASHENS--WLWWLICAFGFLISIRALIQYVSIKRSWRLLSASAQ 260
            :|||||||.||.|||:.||....:.:.  ||||:....|||:.:|..|.|..:::.....|...:
Human   150 ISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPR 214

  Fly   261 ERLLFFY 267
            .|:||.|
Human   215 TRVLFIY 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NdfipNP_730291.1 None
NDFIP1NP_085048.1 Interaction with UBE2L3. /evidence=ECO:0000250|UniProtKB:Q8R0W6 2..41 6/20 (30%)
NDFIP1 16..221 CDD:412069 74/265 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..45 9/42 (21%)
PPxY motif 1 39..42 2/2 (100%)
Interaction with ITCH. /evidence=ECO:0000250|UniProtKB:Q8R0W6 42..76 6/60 (10%)
PPxY motif 2 64..67 2/2 (100%)
PPxY motif 3 74..76 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148555
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4812
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H12730
Inparanoid 1 1.050 112 1.000 Inparanoid score I4861
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1495850at2759
OrthoFinder 1 1.000 - - FOG0002313
OrthoInspector 1 1.000 - - otm42098
orthoMCL 1 0.900 - - OOG6_108283
Panther 1 1.100 - - O PTHR13396
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5682
SonicParanoid 1 1.000 - - X2006
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.