DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ndfip and Ndfip2

DIOPT Version :9

Sequence 1:NP_730291.1 Gene:Ndfip / 326197 FlyBaseID:FBgn0052177 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001177918.1 Gene:Ndfip2 / 76273 MGIID:1923523 Length:338 Species:Mus musculus


Alignment Length:227 Identity:72/227 - (31%)
Similarity:108/227 - (47%) Gaps:36/227 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VQLPSQADLMNAQLPPEIHGKLPTYEEVQMEKSLNGELPPAFLTL----PS-------SQQLP-P 114
            |:.||.:.|           ..||.|......:|:.:.||.:.::    |:       |:..| |
Mouse   123 VEQPSTSSL-----------AAPTVEAAASAPALDPDSPPPYSSITVEAPTTSDTDVYSEFYPVP 176

  Fly   115 PPNPLLPPNPLRDGAAAVRSAQPALTFIAIDASD--------PENSLSTTDNL-LGTDIMFITAF 170
            ||..:....|..|.|...::|  ||...|.||..        |.:..|..:.| :|.|.:|:.||
Mouse   177 PPYSVATSLPTYDEAEKAKAA--ALAAAAADAPQRNQEEDCTPRDDFSDVEQLRVGNDGIFMLAF 239

  Fly   171 IVAFLFNWIGFLMLTCFCHTIAARYGALSGFGLSLAKWTLIVKHSTDLASHENS--WLWWLICAF 233
            .:||:|||:||.:..|..:|||.||||:.||||||.||.|||:.|.....:.|.  ||||:....
Mouse   240 FMAFIFNWLGFCLSFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFLVL 304

  Fly   234 GFLISIRALIQYVSIKRSWRLLSASAQERLLF 265
            |.|:..|..:.|:.::.....::|:.:.|..|
Mouse   305 GLLLFFRGFVNYLKVRNMSESMAAAHRTRYFF 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NdfipNP_730291.1 None
Ndfip2NP_001177918.1 ABC2_membrane <233..300 CDD:304374 34/66 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838662
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4812
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4877
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002313
OrthoInspector 1 1.000 - - otm44152
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13396
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5682
SonicParanoid 1 1.000 - - X2006
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.