DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ndfip and Ndfip1

DIOPT Version :9

Sequence 1:NP_730291.1 Gene:Ndfip / 326197 FlyBaseID:FBgn0052177 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001342678.1 Gene:Ndfip1 / 65113 MGIID:1929601 Length:221 Species:Mus musculus


Alignment Length:268 Identity:77/268 - (28%)
Similarity:106/268 - (39%) Gaps:75/268 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NQPSPGDDQLGPPKADFSAPPPYEANVGHGQQVALPAQMPPLALATPDPSQIPIQMQVQLPSQAD 69
            |:..||:    |.:....|||||.:........          ....|.|..|            
Mouse    24 NEEEPGE----PEQTAGDAPPPYSSITAESAAY----------FDYKDESGFP------------ 62

  Fly    70 LMNAQLPP--EIHGKLPTYEEVQMEKSLNGELPPAFLTLPSSQQLPPPPNPLLPPNPLRDGAAAV 132
                 .||  .:...||:|:|.:..|:                      ...:|..|.||.    
Mouse    63 -----KPPSYNVATTLPSYDEAERTKT----------------------EATIPLVPGRDE---- 96

  Fly   133 RSAQPALTFIAIDASDPENSLSTTDNL-LGTDIMFITAFIVAFLFNWIGFLMLTCFCHTIAARYG 196
                   .|:..|..|      .||.| :|.|.:|:..|.:|||||||||.:..|...:.|.|||
Mouse    97 -------DFVGRDDFD------DTDQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRYG 148

  Fly   197 ALSGFGLSLAKWTLIVKHSTDLASHENS--WLWWLICAFGFLISIRALIQYVSIKRSWRLLSASA 259
            |:|||||||.||.|||:.||....:.:.  ||||:....|||:.:|..|.|..:::.....|...
Mouse   149 AISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKVRKMPETFSNLP 213

  Fly   260 QERLLFFY 267
            :.|:||.|
Mouse   214 RTRVLFIY 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NdfipNP_730291.1 None
Ndfip1NP_001342678.1 Interaction with UBE2L3. /evidence=ECO:0000269|PubMed:25632008 2..41 6/20 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..44 9/23 (39%)
PPxY motif 1 39..42 2/2 (100%)
Interaction with ITCH. /evidence=ECO:0000269|PubMed:25632008 42..76 8/60 (13%)
PPxY motif 2 64..67 2/2 (100%)
PPxY motif 3 74..76 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838661
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4812
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H12730
Inparanoid 1 1.050 109 1.000 Inparanoid score I4877
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1495850at2759
OrthoFinder 1 1.000 - - FOG0002313
OrthoInspector 1 1.000 - - otm44152
orthoMCL 1 0.900 - - OOG6_108283
Panther 1 1.100 - - O PTHR13396
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5682
SonicParanoid 1 1.000 - - X2006
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.790

Return to query results.
Submit another query.