DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ndfip and ndfip1

DIOPT Version :9

Sequence 1:NP_730291.1 Gene:Ndfip / 326197 FlyBaseID:FBgn0052177 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_012814609.1 Gene:ndfip1 / 613097 XenbaseID:XB-GENE-961957 Length:228 Species:Xenopus tropicalis


Alignment Length:281 Identity:81/281 - (28%)
Similarity:113/281 - (40%) Gaps:84/281 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NQPSPGDDQLGPPKADFSAPPPYEANVGHGQQVALPAQMPPLALATPDPSQIPIQMQVQLPSQAD 69
            |:..||::    |:|...|||||.:..|...                           .|....|
 Frog    14 NEEEPGEN----PQASTDAPPPYSSIAGESS---------------------------GLFDYKD 47

  Fly    70 LMNAQLPP--EIHGKLPTYEEVQMEKSLNGELPPAFLTLPSSQQLPPPPNPLLP----------- 121
            .:....||  .:...||:|:|.:..|        |..|:           ||:|           
 Frog    48 ELGFPKPPSYNVATSLPSYDEAERTK--------AEATI-----------PLVPGRHRERLDTFD 93

  Fly   122 ---PNPLRDGAAAVRSAQPALTFIAIDASDPENSLSTTDNLLGTDIMFITAFIVAFLFNWIGFLM 183
               |..|.|.           .|:|.|..|..:.|.     :|.|.:|:..|.:|||||||||.:
 Frog    94 DFFPISLEDD-----------DFVARDDFDDADQLR-----IGNDGIFMLTFFMAFLFNWIGFFL 142

  Fly   184 LTCFCHTIAARYGALSGFGLSLAKWTLIVKHSTDLASHENS--WLWWLICAFGFLISIRALIQYV 246
            ..|...:.|.||||:|||||||.||.|||:.||....:.:.  ||||:....|||:.:|..|.|.
 Frog   143 SFCLTSSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYA 207

  Fly   247 SIKRSWRLLSASAQERLLFFY 267
            .:::.....|...:.|:||.|
 Frog   208 KVRKMPDNFSTLPRTRVLFIY 228



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 105 1.000 Domainoid score I6581
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H12730
Inparanoid 1 1.050 105 1.000 Inparanoid score I4808
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1495850at2759
OrthoFinder 1 1.000 - - FOG0002313
OrthoInspector 1 1.000 - - otm49331
Panther 1 1.100 - - O PTHR13396
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5682
SonicParanoid 1 1.000 - - X2006
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.100

Return to query results.
Submit another query.