DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ndfip and ndfip2

DIOPT Version :9

Sequence 1:NP_730291.1 Gene:Ndfip / 326197 FlyBaseID:FBgn0052177 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001016994.1 Gene:ndfip2 / 549748 XenbaseID:XB-GENE-1014517 Length:254 Species:Xenopus tropicalis


Alignment Length:272 Identity:78/272 - (28%)
Similarity:116/272 - (42%) Gaps:58/272 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NNQPSPGDDQLGPPKADFSAPPPYEANVGHGQQVALPAQMPPLALATPDPSQIPIQMQVQLPSQA 68
            :.|||.. .|.....:|.| ||||.:.|               |..|.|..           :.:
 Frog    33 STQPSQA-AQTSSSASDVS-PPPYSSIV---------------AGTTTDAE-----------TSS 69

  Fly    69 DLMNAQLPPEIHGKLPTYEEVQMEKSLNGELPPAFLTLPSSQQLPPPPNPLLPPNPLRDGAAAVR 133
            |......|..:...||||:|.:..|:      .|...:.:..|              |.|  .:|
 Frog    70 DFYPVPPPYSVATTLPTYDEAEKAKA------AALAAVAAEAQ--------------RHG--QIR 112

  Fly   134 SAQPALTFIAIDASD-----PENSLSTTDNL-LGTDIMFITAFIVAFLFNWIGFLMLTCFCHTIA 192
            .::.....|.:..::     |.:..|..|.| :|.|.:|:.||.:||:||||||.:..|..:|||
 Frog   113 DSRSLFDEIFLSPTEEEEYPPRDDFSDADQLRVGNDGIFMLAFFMAFIFNWIGFCLSFCITNTIA 177

  Fly   193 ARYGALSGFGLSLAKWTLIVKHSTDLASHENS--WLWWLICAFGFLISIRALIQYVSIKRSWRLL 255
            .||||:.||||||.||.|||:.|.....:.|.  ||||:....|.|:..|..:.|:.::.....:
 Frog   178 GRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFLVLGLLLFFRGFVNYLKVRNMSESM 242

  Fly   256 SASAQERLLFFY 267
            :|:.:.|..|.|
 Frog   243 AAAHRTRFFFLY 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NdfipNP_730291.1 None
ndfip2NP_001016994.1 PRK10856 <7..>86 CDD:236776 17/80 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 105 1.000 Domainoid score I6581
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 105 1.000 Inparanoid score I4808
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1495850at2759
OrthoFinder 1 1.000 - - FOG0002313
OrthoInspector 1 1.000 - - otm49331
Panther 1 1.100 - - LDO PTHR13396
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2006
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.