DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ndfip and NDFIP2

DIOPT Version :9

Sequence 1:NP_730291.1 Gene:Ndfip / 326197 FlyBaseID:FBgn0052177 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_061953.2 Gene:NDFIP2 / 54602 HGNCID:18537 Length:336 Species:Homo sapiens


Alignment Length:279 Identity:85/279 - (30%)
Similarity:119/279 - (42%) Gaps:47/279 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GDDQLGPPKADFSAPPPYEANVGHGQ------QVALPAQ--MPPLALATPDPSQIPIQMQVQLPS 66
            |:|.|.      ..|.|....:.|.|      ||.|..:  ....|:..| |:..|....||..|
Human    80 GEDSLS------RKPDPEPGRMDHHQPGTGRYQVLLNEEDNSESSAIEQP-PTSNPAPQIVQAAS 137

  Fly    67 QADLMNAQLPPEIHGKLPTYEEVQME------KSLNGELPPAFLTLPSSQQLPPPPNPLLPPNPL 125
            .|..:.....|      |.|..:.:|      ..:.||..|.           |||..:....|.
Human   138 SAPALETDSSP------PPYSSITVEVPTTSDTEVYGEFYPV-----------PPPYSVATSLPT 185

  Fly   126 RDGA----AAVRSAQPALTFIAIDASD--PENSLSTTDNL-LGTDIMFITAFIVAFLFNWIGFLM 183
            .|.|    ||..:|..|.|...|...:  |.:..|..|.| :|.|.:|:.||.:||:|||:||.:
Human   186 YDEAEKAKAAAMAAAAAETSQRIQEEECPPRDDFSDADQLRVGNDGIFMLAFFMAFIFNWLGFCL 250

  Fly   184 LTCFCHTIAARYGALSGFGLSLAKWTLIVKHSTDLASHENS--WLWWLICAFGFLISIRALIQYV 246
            ..|..:|||.||||:.||||||.||.|||:.|.....:.|.  ||||:....|.|:..|..:.|:
Human   251 SFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFLVLGLLLFFRGFVNYL 315

  Fly   247 SIKRSWRLLSASAQERLLF 265
            .::.....::|:.:.|..|
Human   316 KVRNMSESMAAAHRTRYFF 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NdfipNP_730291.1 None
NDFIP2NP_061953.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..156 21/88 (24%)
Interaction with NEDD4. /evidence=ECO:0000250 148..151 2/8 (25%)
PPxY motif 1 148..151 2/8 (25%)
PPxY motif 2 174..177 2/2 (100%)
PPxY motif 3 184..186 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148554
Domainoid 1 1.000 111 1.000 Domainoid score I6227
eggNOG 1 0.900 - - E1_KOG4812
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 112 1.000 Inparanoid score I4861
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1495850at2759
OrthoFinder 1 1.000 - - FOG0002313
OrthoInspector 1 1.000 - - otm42098
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13396
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5682
SonicParanoid 1 1.000 - - X2006
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.930

Return to query results.
Submit another query.