DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ndfip and ndfip1l

DIOPT Version :9

Sequence 1:NP_730291.1 Gene:Ndfip / 326197 FlyBaseID:FBgn0052177 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_005173929.1 Gene:ndfip1l / 436776 ZFINID:ZDB-GENE-040718-207 Length:227 Species:Danio rerio


Alignment Length:271 Identity:77/271 - (28%)
Similarity:115/271 - (42%) Gaps:58/271 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPHNNQPSPGDDQLGPPKADFSAPPPYEANVGHGQQVALPAQMPPLALATPDPSQIPIQMQVQLP 65
            :|...:|..|      |:....|||||.                  ::|....:....:.....|
Zfish    11 LPCEEEPEAG------PQVAADAPPPYS------------------SIAADSAAFFDYKDDAAFP 51

  Fly    66 SQADLMNAQLPP--EIHGKLPTYEEVQMEKSLNGELPPAFLTLPSSQQLPPPPNPLLPPNPLRDG 128
            :         ||  .:...||:|:|.:..|:   |.....::....::|          :.|.| 
Zfish    52 N---------PPSYNVATSLPSYDEAERTKT---ETSVPLVSGRHRERL----------DTLDD- 93

  Fly   129 AAAVRSAQPALTFIAIDASDPENSLSTTDNLLGTDIMFITAFIVAFLFNWIGFLMLTCFCHTIAA 193
              ..|.|.....|:|.|..:..:.|.     :|.|.:|:..|.:|||||||||.:..|...:.|.
Zfish    94 --VTRCALEDDDFVARDDFEDADQLR-----IGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAG 151

  Fly   194 RYGALSGFGLSLAKWTLIVKHSTDLASHENS--WLWWLICAFGFLISIRALIQYVSIKRSWRLLS 256
            ||||:|||||||.||.|||:.||....:.:.  ||||:....|||:.:|..|.|..|::.....|
Zfish   152 RYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKIRKMADSFS 216

  Fly   257 ASAQERLLFFY 267
            ...:.|:||.|
Zfish   217 TLPRTRVLFIY 227



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582466
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 110 1.000 Inparanoid score I4865
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1495850at2759
OrthoFinder 1 1.000 - - FOG0002313
OrthoInspector 1 1.000 - - otm25296
orthoMCL 1 0.900 - - OOG6_108283
Panther 1 1.100 - - O PTHR13396
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5682
SonicParanoid 1 1.000 - - X2006
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.930

Return to query results.
Submit another query.