DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ndfip and Ndfip2

DIOPT Version :9

Sequence 1:NP_730291.1 Gene:Ndfip / 326197 FlyBaseID:FBgn0052177 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001101860.2 Gene:Ndfip2 / 361089 RGDID:1309716 Length:337 Species:Rattus norvegicus


Alignment Length:273 Identity:85/273 - (31%)
Similarity:117/273 - (42%) Gaps:57/273 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HN---NQPSPGDDQLGPPKADFSAPPPYEANVGHGQQVALPAQMPPLALATPDPSQIPIQMQVQL 64
            ||   |..|...:|   |.|..||..|.||          .|..|.|...:..|....|.:....
  Rat   110 HNEDDNSESSAPEQ---PSASSSAAQPVEA----------AASAPALDADSSPPPYSSITVDGPT 161

  Fly    65 PSQADLMNA--QLPP--EIHGKLPTYEEVQMEKSLNGELPPAFLTLPS-SQQLPPPPNPLLPPNP 124
            .|.||:.:.  .:||  .:...||||:|.  ||:....|..|....|. :|:...||        
  Rat   162 TSDADVYSEFYPVPPPYSVATSLPTYDEA--EKAKAAALAAAAADAPQRNQEEECPP-------- 216

  Fly   125 LRDGAAAVRSAQPALTFIAIDASDPENSLSTTDNLLGTDIMFITAFIVAFLFNWIGFLMLTCFCH 189
             ||                 |.||.|..      .:|.|.:|:.||.:||:|||:||.:..|..:
  Rat   217 -RD-----------------DFSDVEQL------RVGNDGIFMLAFFMAFIFNWLGFCLSFCITN 257

  Fly   190 TIAARYGALSGFGLSLAKWTLIVKHSTDLASHENS--WLWWLICAFGFLISIRALIQYVSIKRSW 252
            |||.||||:.||||||.||.|||:.|.....:.|.  ||||:....|.|:..|..:.|:.::...
  Rat   258 TIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFLVLGLLLFFRGFVNYLKVRNMS 322

  Fly   253 RLLSASAQERLLF 265
            ..::|:.:.|..|
  Rat   323 ESMAAAHRTRYFF 335



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342451
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4812
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I4818
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1495850at2759
OrthoFinder 1 1.000 - - FOG0002313
OrthoInspector 1 1.000 - - otm46248
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13396
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2006
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.860

Return to query results.
Submit another query.