DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ndfip and ndfip1

DIOPT Version :9

Sequence 1:NP_730291.1 Gene:Ndfip / 326197 FlyBaseID:FBgn0052177 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_955960.1 Gene:ndfip1 / 324047 ZFINID:ZDB-GENE-030131-2767 Length:211 Species:Danio rerio


Alignment Length:204 Identity:72/204 - (35%)
Similarity:101/204 - (49%) Gaps:35/204 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 EKSLNG-----ELPPAFLTLPSS----------QQLPPPPNPLLPPN-PLRDGA--AAVRSAQPA 138
            |:|..|     :.||.:.:|.:|          :..|.||:..:..: |..|.|  :...:..|.
Zfish    15 EESAEGFQQTADAPPPYSSLGASNAAFFEYKEDEVYPKPPSYNVATSLPSYDEAERSKAEATVPL 79

  Fly   139 LT-----FIAIDASDPENSLSTTDNL-LGTDIMFITAFIVAFLFNWIGFLMLTCFCHTIAARYGA 197
            :|     |||.|      |...||.| :|.|.:|:..|.:|||||||||.:..|...:.|.||||
Zfish    80 VTDRDEDFIARD------SFEDTDQLRVGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRYGA 138

  Fly   198 LSGFGLSLAKWTLIVKHSTDLASHENS--WLWWLICAFGFLISIRALIQYVSIKRSW--RLLSAS 258
            :|||||||.||.|||:.||....:.:.  ||||:....|||:..|..:.| |..|:.  ..:|..
Zfish   139 ISGFGLSLVKWVLIVRFSTYFPGYFDGQYWLWWVFLVVGFLLFFRGFVNY-SRDRNMADHSMSTL 202

  Fly   259 AQERLLFFY 267
            .:.|:||.|
Zfish   203 PRTRVLFIY 211



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582468
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4812
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H12730
Inparanoid 1 1.050 110 1.000 Inparanoid score I4865
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1495850at2759
OrthoFinder 1 1.000 - - FOG0002313
OrthoInspector 1 1.000 - - otm25296
orthoMCL 1 0.900 - - OOG6_108283
Panther 1 1.100 - - O PTHR13396
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2006
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.760

Return to query results.
Submit another query.