DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sunn and VMP1

DIOPT Version :9

Sequence 1:NP_729739.3 Gene:sunn / 326196 FlyBaseID:FBgn0052088 Length:952 Species:Drosophila melanogaster
Sequence 2:NP_001316324.1 Gene:VMP1 / 81671 HGNCID:29559 Length:419 Species:Homo sapiens


Alignment Length:473 Identity:96/473 - (20%)
Similarity:160/473 - (33%) Gaps:142/473 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 TLSQRQHQEQEIEQHILETYVKIPQNPRKNITYEQFRNELTRYLKTLIQYFPPLQEFDFYARVLT 417
            ::::::.:|:|..|:|:     :.:.|.  ||.:.|..|:...||            ::.:::..
Human    29 SVNEKKRREREERQNIV-----LWRQPL--ITLQYFSLEILVILK------------EWTSKLWH 74

  Fly   418 ARNVRIE-LSLIAAQCASIIFEMHMAEYTSLPVARDQVNELL-RVWSRILKASSKQNGTRPLIYS 480
            .:::.:. |.|:|...|:...|....:|    |.|.:...|| ..|..:...||...||....:.
Human    75 RQSIVVSFLLLLAVLIATYYVEGVHQQY----VQRIEKQFLLYAYWIGLGILSSVGLGTGLHTFL 135

  Fly   481 IYDLIDFDSVA----ECDADLLLNLESSCLENF----LNDDTIIESEFQRLYVNISRSVGATGNI 537
            :|......||.    ||::           .||    ..|..|...|           .|..|.|
Human   136 LYLGPHIASVTLAAYECNS-----------VNFPEPPYPDQIICPDE-----------EGTEGTI 178

  Fly   538 QIHTTTSRALRDEQA----------------ALQLRLNNTDPESPEMQQLLKEYAFSYMRIHAVL 586
            .:.:..|: :|.|..                |...||:..:|:..|.|:      |..|..||  
Human   179 SLWSIISK-VRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQE------FEEMLEHA-- 234

  Fly   587 MVNKLHVRYVADIYETLAKFVLEMPTLNENITLYG---SESLANMLVLLHGDLKDSDGEMIDKVS 648
                    ..|..:.:.||  |.:..|.:.:..:|   ..|:.|.|..|.|         |....
Human   235 --------ESAQDFASRAK--LAVQKLVQKVGFFGILACASIPNPLFDLAG---------ITCGH 280

  Fly   649 GLVKQLQDFCVSELRKEKLNLKRAKFFVCSTLIMHI--NQLPYLSL-DSAAYDKILEVLTSPPRE 710
            .||.....|..:.:.|..:.:...|.||..|...||  ..:.::.| |:.|       |..||..
Human   281 FLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGLEDNGA-------LQPPPPS 338

  Fly   711 SPP------ELPSNTYV----ADMHYMFRLLIKTEEFDLPTNRVWKLLMKYKMSSIKCLDTEIED 765
            :.|      :.|...|:    ..:|:       ..|...|....|             |....|.
Human   339 AVPGIGPSLQKPFQEYLEAQRQKLHH-------KSEMGTPQGENW-------------LSWMFEK 383

  Fly   766 LINVFIKYRIESYIHYMS 783
            |:.|.:.|.|.|.|:.|:
Human   384 LVVVMVCYFILSIINSMA 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunnNP_729739.3 None
VMP1NP_001316324.1 SNARE_assoc <247..298 CDD:294297 12/59 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1109
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.