DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sunn and CG32087

DIOPT Version :9

Sequence 1:NP_729739.3 Gene:sunn / 326196 FlyBaseID:FBgn0052088 Length:952 Species:Drosophila melanogaster
Sequence 2:NP_729740.2 Gene:CG32087 / 39323 FlyBaseID:FBgn0052087 Length:407 Species:Drosophila melanogaster


Alignment Length:122 Identity:28/122 - (22%)
Similarity:49/122 - (40%) Gaps:22/122 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 GFKGICLALTV-----DVRYGIFYQETCDVVVPPMLDIFRKHYKTFCGPE--KSALDFVYCILTV 240
            ||.||....:|     |:. ||    ||...:.|....|   ..|..|..  |:.:..::.|.::
  Fly   240 GFMGILFCASVPNPLFDLA-GI----TCGHFLVPFWKFF---VATLIGKALIKATIQQLFVIASL 296

  Fly   241 VMSEDDCYIKAYEFL-------ESMIRQFAENSQHSHHLRCFTNELITVKYVVLQFE 290
            ..|..|.::.....|       :.|||:..::::...|....:|.|..:.::|..||
  Fly   297 TESLVDRFVVGLGKLPYLGPPMQRMIRELLQSTKQQMHGTVNSNSLAYLSHLVRAFE 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunnNP_729739.3 None
CG32087NP_729740.2 SNARE_assoc <233..282 CDD:294297 14/49 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1109
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.