DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sunn and epg-3

DIOPT Version :10

Sequence 1:NP_729739.3 Gene:sunn / 326196 FlyBaseID:FBgn0052088 Length:952 Species:Drosophila melanogaster
Sequence 2:NP_499688.2 Gene:epg-3 / 176712 WormBaseID:WBGene00012559 Length:458 Species:Caenorhabditis elegans


Alignment Length:77 Identity:23/77 - (29%)
Similarity:31/77 - (40%) Gaps:17/77 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 TLQRNVASAECFTKRFH-------EELLHLVLRM--------SVSSATVASMAAKVYITLSQRQH 359
            ||.|.......|.:|.|       .|:.||.:.:        :|...|..|:...||...:...|
 Worm    46 TLNRMERETIVFWRRPHIVIPYALMEIAHLAVELFFKILAHKTVLLLTAISIGLAVYGYHAPGAH 110

  Fly   360 QE--QEIEQHIL 369
            ||  |.||:|||
 Worm   111 QEHVQTIEKHIL 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunnNP_729739.3 None
epg-3NP_499688.2 SNARE_assoc <257..313 CDD:469768
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.