DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32075 and LAS1L

DIOPT Version :9

Sequence 1:NP_001246712.1 Gene:CG32075 / 326192 FlyBaseID:FBgn0052075 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_112483.1 Gene:LAS1L / 81887 HGNCID:25726 Length:734 Species:Homo sapiens


Alignment Length:531 Identity:110/531 - (20%)
Similarity:198/531 - (37%) Gaps:125/531 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VVTPWRDTLEFNTTYKWLFGKSNTPATWRQALSKIRIWCLRRGSLCPAAVLATSVLVQAHLEDQE 104
            :|..|....|::....:||  .:.....|.||::|.:|..|.|:..|.||.:|:.|::..|.|..
Human    41 IVVAWLSRAEWDQVTVYLF--CDDHKLQRYALNRITVWRSRSGNELPLAVASTADLIRCKLLDVT 103

  Fly   105 ---GSAKIQDTYASAFTRFYNFMSSIIQGHNMSSMYETAKELGLQSFIVDLRHLCAHGQELPPVE 166
               |:.:::..|..|..||.|.:|..........:...|:|:.:..:||||||...| :::|.:.
Human   104 GGLGTDELRLLYGMALVRFVNLISERKTKFAKVPLKCLAQEVNIPDWIVDLRHELTH-KKMPHIN 167

  Fly   167 VLRNTSNHCLEWLRTYYWLPHMET-------MSNLDAGKLHRKDKLKFEKAVTDLLEIYDLTLEC 224
            ..|......|:||:..||...:|.       :.....| :..:|:.:.:..|.|     |:|.:.
Human   168 DCRRGCYFVLDWLQKTYWCRQLENSLRETWELEEFREG-IEEEDQEEDKNIVVD-----DITEQK 226

  Fly   225 HIKGAEKLKAISKLKSSGEFNKIRVYSSSKKAKTSKEILSAVLGDLSALVKKESSSMKDLLDIYT 289
            .....:.....|.:|:.|:            :|.|:|:.|..         |::.|.|:|   |.
Human   227 PEPQDDGKSTESDVKADGD------------SKGSEEVDSHC---------KKALSHKEL---YE 267

  Fly   290 KCLLKMKYFLGVGLEIDDNEDVIIAATQGLFRLLAVQGYIEKVFLA-----------LVQLSENQ 343
            :.                 .:::::..:..|.:|....|:.|...|           |.:|....
Human   268 RA-----------------RELLVSYEEEQFTVLEKFRYLPKAIKAWNNPSPRVECVLAELKGVT 315

  Fly   344 NESEQRRLGASYWAKKMLETFGMLFRMKRMYKAELDLNDKLKPADFATLNTDKISKTMRSLLVHS 408
            .|:.:..|.|......::.||..|..::..|:   |...:::..:    .||..|        |.
Human   316 CENREAVLDAFLDDGFLVPTFEQLAALQIEYE---DGQTEVQRGE----GTDPKS--------HK 365

  Fly   409 NADLSVTLIFGDNPKKSRSLIFDRDFIMQRVDAFSNYSAPILKGLLPLADPPYTKTQIE----DL 469
            |.||:..|:    ||                 .||.:..|:|:|   |....:|:..:|    :|
Human   366 NVDLNDVLV----PK-----------------PFSQFWQPLLRG---LHSQNFTQALLERMLSEL 406

  Fly   470 TKLCDAQLEEFYEEEAMEE--DSSSEESNNLDRLERFLEQAAQSKEHTSDWGVWKLDKHTDWPK- 531
            ..|..:.:...|......|  .::::...|..|.      :|...|....|.::......|||: 
Human   407 PALGISGIRPTYILRWTVELIVANTKTGRNARRF------SAGQWEARRGWRLFNCSASLDWPRM 465

  Fly   532 --CALGVLPWA 540
              ..||...||
Human   466 VESCLGSPCWA 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32075NP_001246712.1 Las1 42..186 CDD:281960 41/146 (28%)
LAS1LNP_112483.1 Las1 43..187 CDD:281960 41/146 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..255 12/68 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 547..619
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158367
Domainoid 1 1.000 59 1.000 Domainoid score I10740
eggNOG 1 0.900 - - E1_KOG2425
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1070386at2759
OrthoFinder 1 1.000 - - FOG0005077
OrthoInspector 1 1.000 - - oto88971
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15002
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R650
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.