DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment para and CATSPER3

DIOPT Version :9

Sequence 1:NP_001259619.1 Gene:para / 32619 FlyBaseID:FBgn0285944 Length:2145 Species:Drosophila melanogaster
Sequence 2:NP_821138.1 Gene:CATSPER3 / 347732 HGNCID:20819 Length:398 Species:Homo sapiens


Alignment Length:402 Identity:90/402 - (22%)
Similarity:165/402 - (41%) Gaps:92/402 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1609 QAIVFEIVTDKKFDIIIMLFIGLNMFTMTL-DRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFA 1672
            :|.|..::..:.|.||::..:..|.|.|.| ..||.......:|::....||.|.:||..:|::.
Human    40 RAFVKRVIMSRFFKIIMISTVTSNAFFMALWTSYDIRYRLFRLLEFSEIFFVSICTSELSMKVYV 104

  Fly  1673 LRYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTL 1737
            ...:|:...:||.||:::|:..|...|..::.|.|   |.|.:....:..|:|:|:..::|||||
Human   105 DPINYWKNGYNLLDVIIIIVMFLPYALRQLMGKQF---TYLYIADGMQSLRILKLIGYSQGIRTL 166

  Fly  1738 LFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMILLFQMSTSA 1802
            :.|:..::..:.::.|||||:|:||||.|  |.:.....:|.:|  |:.....:...||.::|..
Human   167 ITAVGQTVYTVASVLLLLFLLMYIFAILG--FCLFGSPDNGDHD--NWGNLAAAFFTLFSLATVD 227

  Fly  1803 GWDGVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQAT 1867
            ||..:...:.|.|                 ..:...|.:.:::::..|.:||::.|::.:    |
Human   228 GWTDLQKQLDNRE-----------------FALSRAFTIIFILLASFIFLNMFVGVMIMH----T 271

  Fly  1868 ED------------VQEGLTDD----------------------DYDMYYEIWQQF--------- 1889
            ||            .||.|..:                      |...:.|:.:.|         
Human   272 EDSIRKFERELMLEQQEMLMGEKQVILQRQQEEISRLMHIQKNADCTSFSELVENFKKTLSHTDP 336

  Fly  1890 ---DPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGDLMY-CVDILDALTKDFF 1950
               |..||..       .|:|:....|.......:|:         .:|.| .|.:|..:.:|..
Human   337 MVLDDFGTSL-------PFIDIYFSTLDYQDTTVHKL---------QELYYEIVHVLSLMLEDLP 385

  Fly  1951 ARKGNPIEETGE 1962
            ..|...:|:..|
Human   386 QEKPQSLEKVDE 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
paraNP_001259619.1 Ion_trans 165..436 CDD:278921
Na_trans_cytopl 515..648 CDD:288761
Ion_trans 835..1028 CDD:278921
Na_trans_assoc 1054..1296 CDD:284034
Ion_trans 1318..1571 CDD:278921
Na_channel_gate 1561..1613 CDD:240441 1/3 (33%)
Ion_trans 1636..1871 CDD:278921 62/247 (25%)
GPHH 1880..1930 CDD:293510 9/61 (15%)
CATSPER3NP_821138.1 Ion_trans 72..269 CDD:278921 57/220 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.