DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment para and TPCN2

DIOPT Version :9

Sequence 1:NP_001259619.1 Gene:para / 32619 FlyBaseID:FBgn0285944 Length:2145 Species:Drosophila melanogaster
Sequence 2:NP_620714.2 Gene:TPCN2 / 219931 HGNCID:20820 Length:752 Species:Homo sapiens


Alignment Length:704 Identity:144/704 - (20%)
Similarity:248/704 - (35%) Gaps:239/704 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1344 VIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRALRPLR 1408
            ::|..::.:|....|:..:..|.|.....|:::|||:::..||    .:...:.:|..|.|||..
Human   134 LVFAADLSVKGYLFGWAHFQKNLWLLGYLVVLVVSLVDWTVSL----SLVCHEPLRIRRLLRPFF 194

  Fly  1409 AMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIP 1473
            .:.....|:..:..:..::|.:.:|.|:..|...:|.:.|:.||||.  |.:|            
Human   195 LLQNSSMMKKTLKCIRWSLPEMASVGLLLAIHLCLFTMFGMLLFAGG--KQDD------------ 245

  Fly  1474 NRNACESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYL 1538
               ..:.|..|:      |.::..:...|..:.|......:|..|......              
Human   246 ---GQDRERLTY------FQNLPESLTSLLVLLTTANNPDVMIPAYSKNRA-------------- 287

  Fly  1539 YFVFFIIF---GSFFTLNLFIGVIIDNFN------------------------------------ 1564
            |.:|||:|   ||.|.:||...:|...|.                                    
Human   288 YAIFFIVFTVIGSLFLMNLLTAIIYSQFRGYLMKSLQTSLFRRRLGTRAAFEVLSSMVGEGGAFP 352

  Fly  1565 ---------------------------EQKKKAGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIP 1602
                                       .:|.::.||:.:...|.||.:....:.:..:.|    |
Human   353 QAVGVKPQNLLQVLQKVQLDSSHKQAMMEKVRSYGSVLLSAEEFQKLFNELDRSVVKEHP----P 413

  Fly  1603 RPRWRP---QAIVFEIVTDKKFD-----------IIIMLFIGLNMFTMTLDRYDASDTYNAVLDY 1653
            ||.::.   |:..| :.....||           :.|.:|:.|:...:..:|.|      .:|..
Human   414 RPEYQSPFLQSAQF-LFGHYYFDYLGNLIALANLVSICVFLVLDADVLPAERDD------FILGI 471

  Fly  1654 LNAIFVVIFSSECLLKIFALRYH-YFIEPWNLFD----VVVVILSI-----------------LG 1696
            ||.:|:|.:..|.|||:|||... |...|.|:||    ||:::|.|                 :|
Human   472 LNCVFIVYYLLEMLLKVFALGLRGYLSYPSNVFDGLLTVVLLVLEISTLAVYRLPHPGWRPEMVG 536

  Fly  1697 LV-LSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAK---GIRTLLFALAMSLPALFNICLLLFL 1757
            |: |.|          :.|::.:..|.|.||::...|   .:.:.:..|..::.|...|   |.:
Human   537 LLSLWD----------MTRMLNMLIVFRFLRIIPSMKLMAVVASTVLGLVQNMRAFGGI---LVV 588

  Fly  1758 VMFIFAIFGMSFFMHVKEKSGIND--------------------VYNFKTFGQSMILLFQMSTSA 1802
            |.::|||.|::.|..|......|.                    ..||..|..:::.|:.:....
Human   589 VYYVFAIIGINLFRGVIVALPGNSSLAPANGSAPCGSFEQLEYWANNFDDFAAALVTLWNLMVVN 653

  Fly  1803 GWDGVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQAT 1867
            .|...|||.            :.|.|....    |.|:|.:|| |.:|.:|:::|:||||:    
Human   654 NWQVFLDAY------------RRYSGPWSK----IYFVLWWLV-SSVIWVNLFLALILENF---- 697

  Fly  1868 EDVQEGLTDDDYDMYYEIWQQFDPE-------GTQYIRYDQLSE--FLDVLEPP 1912
                              ..::||.       ||....|....|  |.|:||.|
Human   698 ------------------LHKWDPRSHLQPLAGTPEATYQMTVELLFRDILEEP 733

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
paraNP_001259619.1 Ion_trans 165..436 CDD:278921
Na_trans_cytopl 515..648 CDD:288761
Ion_trans 835..1028 CDD:278921
Na_trans_assoc 1054..1296 CDD:284034
Ion_trans 1318..1571 CDD:278921 49/292 (17%)
Na_channel_gate 1561..1613 CDD:240441 12/117 (10%)
Ion_trans 1636..1871 CDD:278921 68/280 (24%)
GPHH 1880..1930 CDD:293510 11/42 (26%)
TPCN2NP_620714.2 Ion_trans <184..315 CDD:278921 36/167 (22%)
Ion_trans 468..697 CDD:278921 65/258 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.