DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adi1 and ARD4

DIOPT Version :9

Sequence 1:NP_001097577.1 Gene:Adi1 / 326189 FlyBaseID:FBgn0052068 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_568630.1 Gene:ARD4 / 834407 AraportID:AT5G43850 Length:187 Species:Arabidopsis thaliana


Alignment Length:173 Identity:95/173 - (54%)
Similarity:123/173 - (71%) Gaps:3/173 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VQVWYMDTEETDQRLEHHRNPPAYLELDDLYQKTGVEYFKINADEYQSDNTLTELRAKRGYTYDD 66
            ::.|:||....||||.|||||...:.||.| .:.||.|:|:|.:.|::|:.|:::|..|||.|.|
plant     3 LEAWFMDDSNEDQRLPHHRNPKELVSLDYL-AELGVLYWKLNPENYENDSELSKIREDRGYDYMD 66

  Fly    67 EI-TCSEKCLPDYANKLKAFFTEHLHTDEEIRLILEGSGYFDVRDNEDNWLRIKVVKGDLIIIPA 130
            .: .|.|| :.:|..|||.|||||:|.|||||..|.|||||||||.:|.|:||.:..||||::||
plant    67 LLDLCPEK-VSNYEEKLKNFFTEHIHKDEEIRYCLAGSGYFDVRDKDDRWIRIWMQPGDLIVLPA 130

  Fly   131 GIYHRFTLDTNNFIRTRRYFVGEPVWAPHNRPADEMDCRKSYI 173
            |||||||||.:|:|:..|.|||||||.|:|||.:|...||.||
plant   131 GIYHRFTLDASNYIKLMRLFVGEPVWTPYNRPQEEHPVRKKYI 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adi1NP_001097577.1 cupin_like 3..158 CDD:304367 86/155 (55%)
ARD4NP_568630.1 ARD 4..158 CDD:281122 86/155 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 180 1.000 Domainoid score I1044
eggNOG 1 0.900 - - E1_COG1791
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I1277
OMA 1 1.010 - - QHG55522
OrthoDB 1 1.010 - - D1166094at2759
OrthoFinder 1 1.000 - - FOG0002419
OrthoInspector 1 1.000 - - otm2675
orthoMCL 1 0.900 - - OOG6_102069
Panther 1 1.100 - - O PTHR23418
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2127
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.