DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adi1 and ARD1

DIOPT Version :9

Sequence 1:NP_001097577.1 Gene:Adi1 / 326189 FlyBaseID:FBgn0052068 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_567443.1 Gene:ARD1 / 827124 AraportID:AT4G14716 Length:192 Species:Arabidopsis thaliana


Alignment Length:183 Identity:94/183 - (51%)
Similarity:132/183 - (72%) Gaps:9/183 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVQVWYMDTEETDQRLEHHRNPPAYLELDDLYQKTGVEYFKINADEYQSDNTLTELRAKRGYTYD 65
            ::|.||||..|.||||.||::|..::.||.| .:.||..::::||.|::|..|.::|..|||:|.
plant    12 VIQAWYMDDSEEDQRLPHHKDPKEFVSLDKL-AELGVLSWRLDADNYETDEDLKKIRESRGYSYM 75

  Fly    66 D--EITCSEKCLPDYANKLKAFFTEHLHTDEEIRLILEGSGYFDVRDNEDNWLRIKVVKGDLIII 128
            |  |: |.|| ||:|..|:|:||.||||||||||..:.|:|||||||..:.|:|:.|.||.:|::
plant    76 DFCEV-CPEK-LPNYEVKVKSFFEEHLHTDEEIRYCVAGTGYFDVRDRNEAWIRVLVKKGGMIVL 138

  Fly   129 PAGIYHRFTLDTNNFIRTRRYFVGEPVWAPHNRPADEMDCRKSYIKHQSENFV 181
            |||||||||:|::|:|:..|.|||||||.|:|||.|.:..||.|:    :||:
plant   139 PAGIYHRFTVDSDNYIKAMRLFVGEPVWTPYNRPHDHLPARKEYV----DNFM 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adi1NP_001097577.1 cupin_like 3..158 CDD:304367 84/156 (54%)
ARD1NP_567443.1 ARD 14..168 CDD:281122 84/156 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 180 1.000 Domainoid score I1044
eggNOG 1 0.900 - - E1_COG1791
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H75081
Inparanoid 1 1.050 206 1.000 Inparanoid score I1277
OMA 1 1.010 - - QHG55522
OrthoDB 1 1.010 - - D1166094at2759
OrthoFinder 1 1.000 - - FOG0002419
OrthoInspector 1 1.000 - - otm2675
orthoMCL 1 0.900 - - OOG6_102069
Panther 1 1.100 - - O PTHR23418
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2127
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.