DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adi1 and adi1

DIOPT Version :9

Sequence 1:NP_001097577.1 Gene:Adi1 / 326189 FlyBaseID:FBgn0052068 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_955962.2 Gene:adi1 / 324079 ZFINID:ZDB-GENE-030131-2799 Length:181 Species:Danio rerio


Alignment Length:172 Identity:93/172 - (54%)
Similarity:120/172 - (69%) Gaps:2/172 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QVWYMDTEE-TDQRLEHHRNPPAYLELDDLYQKTGVEYFKINADEYQSDNTLTELRAKRGYTYDD 66
            :.||||.|. .||||.|..:|...:.:..| :..||.::|:|||.|::|..|.::|.::||::.|
Zfish     5 EAWYMDEESGEDQRLPHKLSPNQPVSVQQL-EHIGVFHWKLNADIYENDPELQKIREEKGYSFMD 68

  Fly    67 EITCSEKCLPDYANKLKAFFTEHLHTDEEIRLILEGSGYFDVRDNEDNWLRIKVVKGDLIIIPAG 131
            .||.....||||.||||.|:.||||.|:|||.|||||.||||||..|.|:||.|.|||||.:|||
Zfish    69 IITIHPDKLPDYQNKLKMFYEEHLHLDDEIRYILEGSSYFDVRDEGDRWIRIAVSKGDLITLPAG 133

  Fly   132 IYHRFTLDTNNFIRTRRYFVGEPVWAPHNRPADEMDCRKSYI 173
            ||||||:|.:|:.:..|.|||||||..:|||||:.|.||.|:
Zfish   134 IYHRFTVDESNYTKAMRLFVGEPVWKAYNRPADDFDIRKEYV 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adi1NP_001097577.1 cupin_like 3..158 CDD:304367 84/155 (54%)
adi1NP_955962.2 ARD 5..160 CDD:281122 84/155 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582834
Domainoid 1 1.000 172 1.000 Domainoid score I3685
eggNOG 1 0.900 - - E1_COG1791
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H75081
Inparanoid 1 1.050 194 1.000 Inparanoid score I3828
OMA 1 1.010 - - QHG55522
OrthoDB 1 1.010 - - D1166094at2759
OrthoFinder 1 1.000 - - FOG0002419
OrthoInspector 1 1.000 - - oto41138
orthoMCL 1 0.900 - - OOG6_102069
Panther 1 1.100 - - LDO PTHR23418
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R760
SonicParanoid 1 1.000 - - X2127
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.