DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adi1 and K07E1.1

DIOPT Version :9

Sequence 1:NP_001097577.1 Gene:Adi1 / 326189 FlyBaseID:FBgn0052068 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_494804.2 Gene:K07E1.1 / 24104726 WormBaseID:WBGene00019489 Length:158 Species:Caenorhabditis elegans


Alignment Length:155 Identity:54/155 - (34%)
Similarity:86/155 - (55%) Gaps:2/155 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVQVWYMDTEET-DQRLEHHRNPPAYLELDDLYQKTGVEYFKINA-DEYQSDNTLTELRAKRGYT 63
            |||:|.|:.... |.||.||..||..:..|:|.::||..|:|::. |:......||.|:.:..:.
 Worm     1 MVQIWQMEPYPCGDPRLPHHLFPPKKITPDELSKRTGTLYWKLDTLDQVALAKRLTTLKLEHSFK 65

  Fly    64 YDDEITCSEKCLPDYANKLKAFFTEHLHTDEEIRLILEGSGYFDVRDNEDNWLRIKVVKGDLIII 128
            .:|..|...:...::.:|::..|.|.....|:.|:|:||:.|:||.|....|:||....||||:|
 Worm    66 KEDIFTLDAETTANFDDKIEELFEESSVPFEQARMIIEGTAYYDVEDKNGQWVRIFCEYGDLILI 130

  Fly   129 PAGIYHRFTLDTNNFIRTRRYFVGE 153
            ||....|||...:||::.||::..|
 Worm   131 PANTCFRFTTTPHNFVKMRRFYKDE 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adi1NP_001097577.1 cupin_like 3..158 CDD:304367 52/153 (34%)
K07E1.1NP_494804.2 ARD 3..156 CDD:281122 52/153 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160400
Domainoid 1 1.000 114 1.000 Domainoid score I3800
eggNOG 1 0.900 - - E1_COG1791
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55522
OrthoDB 1 1.010 - - D1166094at2759
OrthoFinder 1 1.000 - - FOG0002419
OrthoInspector 1 1.000 - - otm14063
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23418
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.820

Return to query results.
Submit another query.