DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adi1 and F42F12.4

DIOPT Version :9

Sequence 1:NP_001097577.1 Gene:Adi1 / 326189 FlyBaseID:FBgn0052068 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_510072.1 Gene:F42F12.4 / 181393 WormBaseID:WBGene00009636 Length:178 Species:Caenorhabditis elegans


Alignment Length:171 Identity:61/171 - (35%)
Similarity:88/171 - (51%) Gaps:2/171 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WYMDTEETDQRLEHHRNPPAYLELDDLYQKTGVEYFKINADEYQSDNTLTELRAKRGYTYDDEIT 69
            ::|.....:.|.:..|..|.....::...:.|||..|:|.|:......|..|..|....:.||:.
 Worm     3 YFMTDVTKENRQDECRFSPNKEATEEDLLRIGVECTKVNFDDEHVQEDLDRLIKKYDMNFHDEVH 67

  Fly    70 CSEKCLPDYANKLKAFFTEHLHTDEEIRLILEGSGYFDVRDNEDNWLRIKVVKGDLIIIPAGIYH 134
            .....:|::..||..||.||||.|.|:|:|..|.|:||||..::.|:||.|.:||.:.:||||||
 Worm    68 ICRATMPNFDEKLDIFFEEHLHDDAELRVIKHGVGFFDVRTKDEAWIRIPVRRGDFVFLPAGIYH 132

  Fly   135 RFTLDTNNFIRTRRYFVGEPVWAPHNRPA--DEMDCRKSYI 173
            |||.|.:..:...|.|...|.|...||.|  ||...|:.|:
 Worm   133 RFTTDPSEDVVALRLFRNNPKWTAFNRKADGDEQRVRQQYL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adi1NP_001097577.1 cupin_like 3..158 CDD:304367 54/152 (36%)
F42F12.4NP_510072.1 ARD 1..156 CDD:281122 54/152 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1791
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I3380
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55522
OrthoDB 1 1.010 - - D1166094at2759
OrthoFinder 1 1.000 - - FOG0002419
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102069
Panther 1 1.100 - - LDO PTHR23418
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R760
SonicParanoid 1 1.000 - - X2127
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.