DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adi1 and T01D1.4

DIOPT Version :9

Sequence 1:NP_001097577.1 Gene:Adi1 / 326189 FlyBaseID:FBgn0052068 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_493676.1 Gene:T01D1.4 / 173403 WormBaseID:WBGene00020149 Length:159 Species:Caenorhabditis elegans


Alignment Length:151 Identity:54/151 - (35%)
Similarity:95/151 - (62%) Gaps:3/151 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VQVWYMDTEET-DQRLEHHRNPPAYLELDDLYQKTGVEYFKINADEYQS-DNTLTELRAKRGYTY 64
            :|:|:|:.... |:||.||..||..:....|.|..||:|:|::.|:..| ...|:.::.::..|:
 Worm     1 MQIWHMEPFPCGDRRLPHHVFPPKKITTTQLGQLAGVQYYKVDLDDTASMKKRLSAVKTEKNVTF 65

  Fly    65 DDEITCSEKCLPDYANKLKAFFTEHLHTDEEIRLILEGSGYFDVRDNEDNWLRIKVVKGDLIIIP 129
            .|..|.||..| ::.:|::.|:...:..::.|.|::||:.|:||...:|:|:|::|.|||||:||
 Worm    66 TDMFTVSETML-EFDDKMEQFYEPQVQKEDVISLVVEGTCYYDVEPEDDSWIRVQVEKGDLIVIP 129

  Fly   130 AGIYHRFTLDTNNFIRTRRYF 150
            .|:.||||....||::.:|:|
 Worm   130 KGLSHRFTTTPQNFVKIQRFF 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adi1NP_001097577.1 cupin_like 3..158 CDD:304367 54/150 (36%)
T01D1.4NP_493676.1 ARD 2..158 CDD:281122 54/150 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160401
Domainoid 1 1.000 114 1.000 Domainoid score I3800
eggNOG 1 0.900 - - E1_COG1791
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55522
OrthoDB 1 1.010 - - D1166094at2759
OrthoFinder 1 1.000 - - FOG0002419
OrthoInspector 1 1.000 - - otm14063
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23418
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R760
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.