DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adi1 and Adi1

DIOPT Version :9

Sequence 1:NP_001097577.1 Gene:Adi1 / 326189 FlyBaseID:FBgn0052068 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_598813.1 Gene:Adi1 / 104923 MGIID:2144929 Length:179 Species:Mus musculus


Alignment Length:173 Identity:94/173 - (54%)
Similarity:119/173 - (68%) Gaps:1/173 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVQVWYMDTEETDQRLEHHRNPPAYLELDDLYQKTGVEYFKINADEYQSDNTLTELRAKRGYTYD 65
            |||.||||....|.|..|...|...:.|:.| :..||.|:|::||:|::|..|.::|..|.|::.
Mouse     1 MVQAWYMDESTADPRKPHRAQPDRPVSLEQL-RTLGVLYWKLDADKYENDPELEKIRKMRNYSWM 64

  Fly    66 DEITCSEKCLPDYANKLKAFFTEHLHTDEEIRLILEGSGYFDVRDNEDNWLRIKVVKGDLIIIPA 130
            |.||..:..||:|..|:|.||.||||.|||||.||||||||||||.||.|:||.:.|||:|.:||
Mouse    65 DIITICKDTLPNYEEKIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEKGDMITLPA 129

  Fly   131 GIYHRFTLDTNNFIRTRRYFVGEPVWAPHNRPADEMDCRKSYI 173
            |||||||||..|:::..|.|||||||.|:|||||..|.|..|:
Mouse   130 GIYHRFTLDEKNYVKAMRLFVGEPVWTPYNRPADHFDARVQYM 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adi1NP_001097577.1 cupin_like 3..158 CDD:304367 83/154 (54%)
Adi1NP_598813.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 11/22 (50%)
cupin_ARD 28..157 CDD:380360 73/128 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838958
Domainoid 1 1.000 178 1.000 Domainoid score I3549
eggNOG 1 0.900 - - E1_COG1791
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H75081
Inparanoid 1 1.050 203 1.000 Inparanoid score I3741
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55522
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002419
OrthoInspector 1 1.000 - - oto94615
orthoMCL 1 0.900 - - OOG6_102069
Panther 1 1.100 - - LDO PTHR23418
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R760
SonicParanoid 1 1.000 - - X2127
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.