powered by:
Protein Alignment Adi1 and rdh8
DIOPT Version :9
Sequence 1: | NP_001097577.1 |
Gene: | Adi1 / 326189 |
FlyBaseID: | FBgn0052068 |
Length: | 186 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_031755239.1 |
Gene: | rdh8 / 100498153 |
XenbaseID: | XB-GENE-984982 |
Length: | 335 |
Species: | Xenopus tropicalis |
Alignment Length: | 64 |
Identity: | 17/64 - (26%) |
Similarity: | 23/64 - (35%) |
Gaps: | 20/64 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 KTGVEYFKINADEYQSDNTLTELRAKRGYTYDDEITCSEKCLPDYANKLKAFFTEHLHTDEEIR 97
|..|:..|...:.|....|:.:| .||| ||:|...|.|:...|||
Frog 40 KIAVQLAKDPQERYYVIATMRDL-GKRG-------------------KLEAEVGESLNKTLEIR 83
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1166094at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.