DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adi1 and rdh8

DIOPT Version :9

Sequence 1:NP_001097577.1 Gene:Adi1 / 326189 FlyBaseID:FBgn0052068 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_031755239.1 Gene:rdh8 / 100498153 XenbaseID:XB-GENE-984982 Length:335 Species:Xenopus tropicalis


Alignment Length:64 Identity:17/64 - (26%)
Similarity:23/64 - (35%) Gaps:20/64 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KTGVEYFKINADEYQSDNTLTELRAKRGYTYDDEITCSEKCLPDYANKLKAFFTEHLHTDEEIR 97
            |..|:..|...:.|....|:.:| .|||                   ||:|...|.|:...|||
 Frog    40 KIAVQLAKDPQERYYVIATMRDL-GKRG-------------------KLEAEVGESLNKTLEIR 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adi1NP_001097577.1 cupin_like 3..158 CDD:304367 17/64 (27%)
rdh8XP_031755239.1 NADB_Rossmann 26..283 CDD:419666 17/64 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1166094at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.