DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S-Lap4 and NPEPL1

DIOPT Version :9

Sequence 1:NP_729613.1 Gene:S-Lap4 / 326188 FlyBaseID:FBgn0052064 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_078939.3 Gene:NPEPL1 / 79716 HGNCID:16244 Length:523 Species:Homo sapiens


Alignment Length:340 Identity:79/340 - (23%)
Similarity:128/340 - (37%) Gaps:63/340 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 TRGVFKAEAQNLARRMCDTPACCMTPTLFAQATVDALCPCGITVEIRTMEWIEQQRLHSFLMIAK 254
            |.||      .||.|:.|||...|....|.:.........||...|...|.::.:.......:.|
Human   175 TDGV------RLAARIVDTPCNEMNTDTFLEEINKVGKELGIIPTIIRDEELKTRGFGGIYGVGK 233

  Fly   255 GSCEPPVLMEITYCGTNPE--DKPILFLGKGITFNSGAMNLRKCRGMEEYRACMSGAASCVAMMR 317
            .:..||.|..:::   .|:  .:.|.::||||.:::|.::::....|...:....|||:.:...|
Human   234 AALHPPALAVLSH---TPDGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAVLGAFR 295

  Fly   318 CVAALALPINVCCIIPLCENMPSGMACKPGDVVTLMNHKSMAVRNLDKAGVVVMADPLLYGQSTY 382
            .........|:..:..|.||.....|.:|.|:..|.:.|::.:.|.|..|.:|:||.:.|.....
Human   296 AAIKQGFKDNLHAVFCLAENSVGPNATRPDDIHLLYSGKTVEINNTDAEGRLVLADGVSYACKDL 360

  Fly   383 KPRLVVDVATLGSGVKKAFGGGATGIFSNSHYIWKQFQSAGALTGDRVWRLPLWNYYRK--QITD 445
            ...:::|:|||         .||.||.:..::       |..||....|........||  .:..
Human   361 GADIILDMATL---------TGAQGIATGKYH-------AAVLTNSAEWEAACVKAGRKCGDLVH 409

  Fly   446 EMGY--------------DLSN---DGRGLANSCLAAAVLHEL---VPCVDWAHLD--------T 482
            .:.|              |:.|   |.....:||....:...:   .|.| |.|||        .
Human   410 PLVYCPELHFSEFTSAVADMKNSVADRDNSPSSCAGLFIASHIGFDWPGV-WVHLDIAAPVHAGE 473

  Fly   483 RGTG-----LLTKYG 492
            |.||     ||..:|
Human   474 RATGFGVALLLALFG 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S-Lap4NP_729613.1 PRK00913 31..514 CDD:234863 79/340 (23%)
Peptidase_M17 35..514 CDD:238247 79/340 (23%)
NPEPL1NP_078939.3 Peptidase_M17 35..487 CDD:238247 78/337 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D562530at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.