DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S-Lap4 and zgc:152830

DIOPT Version :9

Sequence 1:NP_729613.1 Gene:S-Lap4 / 326188 FlyBaseID:FBgn0052064 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001070088.1 Gene:zgc:152830 / 767682 ZFINID:ZDB-GENE-090312-55 Length:512 Species:Danio rerio


Alignment Length:393 Identity:82/393 - (20%)
Similarity:142/393 - (36%) Gaps:96/393 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 VVGVGLEGIGFNELEMLDEGMEN--------VRVAAGIGARSLQEIGVSE---VFVDGMDYAEQ- 151
            ||.:.:.|:..|.|.....|..|        .|.||..|.:...:.|:..   |......||:. 
Zfish    57 VVVLRVPGLPGNRLVCSCTGPVNRDYDDVRRFRDAAANGIKRALKAGLQRPLLVCPPNSSYAKNT 121

  Fly   152 --AAEGAVLAVWRYCDMNSKRKPPH-IPKLELYESPDYEGWTRGVFK-AEAQNLAR--------- 203
              |..||:..::...::...:..|| :..|.::.....:|  .|:.: |.|....|         
Zfish   122 LVAVLGALHVLYVPLEVREHKSSPHKVATLGIWVKNKEQG--DGIIELANALESGRFVYRDIGGS 184

  Fly   204 ---RMCDTPACCMTPTLFAQATVDALCPCGITVEIRTMEWIEQQRLHSFLMIAKGSCEPPV---- 261
               ||..........::|..:      |..:|| :..:..:|::..   .:.|...|...|    
Zfish   185 DPERMAAPRVAEYVQSVFKDS------PVKVTV-VSNLNTLEKEYP---CLAAVNRCANAVPRHQ 239

  Fly   262 --LMEITYCGTNPEDKPILFLGKGITFNSGAMNLR-----------KCRGMEEYRACMSGAASCV 313
              ::::.|||..|.::.::.:|||||:::|..:::           ||..     |.::|....:
Zfish   240 ARVIKLQYCGEGPIEQTLMLVGKGITYDTGGADIKAGGIMAGMHGDKCGS-----AAVAGFFQIL 299

  Fly   314 AM-----MRCVAALALPINVCCIIPLCENMPSGMACKPGD-VVTLMNHKSMAVRNLDKAGVVVMA 372
            |.     ::.|.|:|:..|           ..|..|...| :|.....:.:.|.|.|..|.:||.
Zfish   300 AKLKPKHLKVVGAMAMVRN-----------SVGSDCYVADELVVSRAGRRIRVGNTDAEGRMVMV 353

  Fly   373 DPLL----YGQSTYKPRLVVDVATLGSGVKKAFG--------GGATGIFSNSHYIWKQFQSAGAL 425
            |.|.    .......|.|.. :|||.....:|.|        .||.....|.    .::|.||.:
Zfish   354 DLLCEMKEQALQEVSPHLFT-IATLTGHAIRAMGPKYSIIMDNGAARRAGND----LEWQKAGEV 413

  Fly   426 TGD 428
            .||
Zfish   414 LGD 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S-Lap4NP_729613.1 PRK00913 31..514 CDD:234863 82/393 (21%)
Peptidase_M17 35..514 CDD:238247 82/393 (21%)
zgc:152830NP_001070088.1 Peptidase_M17 20..502 CDD:238247 82/393 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D562530at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.