DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S-Lap4 and npepl1

DIOPT Version :9

Sequence 1:NP_729613.1 Gene:S-Lap4 / 326188 FlyBaseID:FBgn0052064 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001017688.1 Gene:npepl1 / 550383 ZFINID:ZDB-GENE-050417-177 Length:525 Species:Danio rerio


Alignment Length:334 Identity:78/334 - (23%)
Similarity:134/334 - (40%) Gaps:54/334 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 AEAQNLARRMCDTPACCMTPTLFAQATVDALCPCGITVEIRTMEWIEQQRLHSFLMIAKGSCEPP 260
            |:...||.|:.|||...|....|.:.........|||..|...|.::|:.......:.|.:..||
Zfish   175 ADGVRLAARIVDTPCSEMNTDDFLEEIKTVGNALGITPTIIRGEELKQKGFGGIYGVGKAALNPP 239

  Fly   261 VLMEITYCGTNPEDKPILFLGKGITFNSGAMNLRKCRGMEEYRACMSGAASCVAMMRCVAALALP 325
            .|..:::..:. ..:.|.::||||.:::|.::::....|...:....|||:.:...:........
Zfish   240 ALAVLSHTPSG-ATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAILGAFKATIKQGFK 303

  Fly   326 INVCCIIPLCENMPSGMACKPGDVVTLMNHKSMAVRNLDKAGVVVMADPLLYGQSTYKPRLVVDV 390
            .|:..:..|.||.....|.:|.|:.||.:.|::.:.|.|..|.:|::|.::|........:::|:
Zfish   304 DNLHAVFCLAENSVGPAATRPDDIHTLYSGKTVEINNTDAEGRLVLSDGVVYASKDLSADIILDM 368

  Fly   391 ATLGSGVKKAFGGGATGIFSNSHYIWKQFQSAGALTGDRVWRL--------------PLW---NY 438
            |||         .||.||.:..|:       |..:|....|.|              ||.   ..
Zfish   369 ATL---------TGAQGISTGKHH-------AAVMTNSEQWELACVRAGRSSGDLAHPLVYCPEL 417

  Fly   439 YRKQITDEMGYDLSN---DGRGLANSCLAAAVLHEL---VPCVDWAHLD--------TRGTGLLT 489
            :..:.|..:. |:.|   |.....:||....:...|   .|.| |.|:|        .|.||   
Zfish   418 HFSEFTSALA-DMKNSVADRENAQSSCAGLFIASHLGFDWPGV-WVHVDIASPVHAGERATG--- 477

  Fly   490 KYGLVPYLT 498
             :|:.|.|:
Zfish   478 -FGVAPLLS 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S-Lap4NP_729613.1 PRK00913 31..514 CDD:234863 78/334 (23%)
Peptidase_M17 35..514 CDD:238247 78/334 (23%)
npepl1NP_001017688.1 Peptidase_M17 22..487 CDD:238247 78/334 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D562530at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.