DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S-Lap4 and grsm

DIOPT Version :9

Sequence 1:NP_729613.1 Gene:S-Lap4 / 326188 FlyBaseID:FBgn0052064 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_731749.3 Gene:grsm / 41587 FlyBaseID:FBgn0040493 Length:655 Species:Drosophila melanogaster


Alignment Length:333 Identity:85/333 - (25%)
Similarity:142/333 - (42%) Gaps:59/333 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 AQNLARRMCDTPACCMTPTLFAQATVDA---LCPCGITVEIRTMEWIEQQRLHSFLMIAKGSCEP 259
            |..:..|:.|.|...|....|.|...|.   ||   ||.::...|.:.:|.......:.|.:..|
  Fly   318 AIRMTARIVDMPCNEMNVDHFIQEVEDVGRELC---ITPKVIRGEELLEQGFGGIYGVGKAAAVP 379

  Fly   260 PVLMEITYCGTNPE--DKPILFLGKGITFNSGAMNLRKCRGMEEYRACMSGAASCVAMMRCVAAL 322
            |.|:.:::   .|:  .:.|..:||||.:::|.::::...||...:....|||:.:.........
  Fly   380 PALVVLSH---EPKGAQETIALVGKGIVYDTGGLSIKAKTGMPGMKRDCGGAAAILGTFYAAVQC 441

  Fly   323 ALPINVCCIIPLCENMPSGMACKPGDVVTLMNHKSMAVRNLDKAGVVVMADPLLYGQSTYKPRLV 387
            ....|:..:..|.||.....|.:|.|:.||.:.:::.:.|.|..|.:|:||.:.|.....|..::
  Fly   442 GFRDNLHAVFCLAENSVGPNATRPDDIHTLYSGRTVEINNTDAEGRLVLADGVCYANKDLKANII 506

  Fly   388 VDVATLGSGVKKAFGGGATG-----IFSNSHYIW--KQFQSAGALTGDRVWRLPL-------WNY 438
            :|:||| :|.:    |.|||     |.:||. .|  |..| ||..:||.:  .|:       ::.
  Fly   507 LDMATL-TGAQ----GVATGKYHGAILTNSE-TWEAKSLQ-AGRKSGDLL--APIIYCPELHFSE 562

  Fly   439 YRKQITDEMGYDLSN---DGRGLANSCLAAAVLHEL---VPCVDWAHLD--------TRGTG--- 486
            :...|.     |:.|   |.:...:||....:...|   .|.: |.|:|        .|.||   
  Fly   563 FASAIA-----DMKNSVADRQNAQSSCAGLFIAAHLGFDYPGI-WMHVDMATPVHCGERATGYGV 621

  Fly   487 --LLTKYG 492
              |||.:|
  Fly   622 SLLLTLFG 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S-Lap4NP_729613.1 PRK00913 31..514 CDD:234863 85/333 (26%)
Peptidase_M17 35..514 CDD:238247 85/333 (26%)
grsmNP_731749.3 Peptidase_M17 141..628 CDD:238247 84/330 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472721
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0260
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D562530at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11963
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.