DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S-Lap4 and Npepl1

DIOPT Version :9

Sequence 1:NP_729613.1 Gene:S-Lap4 / 326188 FlyBaseID:FBgn0052064 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001365722.1 Gene:Npepl1 / 228961 MGIID:2448523 Length:529 Species:Mus musculus


Alignment Length:405 Identity:91/405 - (22%)
Similarity:147/405 - (36%) Gaps:92/405 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 AGIGARSLQEIGVSEVFVDGMDYAEQAAEGAVLAVWRYCDMNSKRKPPHIPKLELYESPDYEGWT 190
            :|...|:.:...:.|.|:.|.|      .|.|......|..|:                     |
Mouse   143 SGASRRAEKRTVMVEFFLVGQD------NGPVEVSTLQCLTNA---------------------T 180

  Fly   191 RGVFKAEAQNLARRMCDTPACCMTPTLFAQATVDALCPCGITVEIRTMEWIEQQRLHSFLMIAKG 255
            .||      .||.|:.|||...|...:|.:..:......|||..|...|.::.:.......:.|.
Mouse   181 EGV------RLAARIVDTPCNEMNTDIFLEEIIQVGKELGITPTIIRDEQLKTKGFGGIYGVGKA 239

  Fly   256 SCEPPVLMEITYCGTNPE--DKPILFLGKGITFNSGAMNLRKCRGMEEYRACMSGAASCVAMMRC 318
            :..||.|..:::   .|:  .:.|.::||||.:::|.::::....|...:....|||:.:...|.
Mouse   240 ALHPPALAILSH---TPDGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAVLGAFRA 301

  Fly   319 VAALALPINVCCIIPLCENMPSGMACKPGDVVTLMNHKSMAVRNLDKAGVVVMADPLLYGQSTYK 383
            ........|:..:..|.||.....|.:|.|:..|.:.|::.:.|.|..|.:|:||.:.|......
Mouse   302 AIKQGFKDNLHAVFCLAENAVGPNATRPDDIHLLYSGKTVEINNTDAEGRLVLADGVSYACKDLG 366

  Fly   384 PRLVVDVATLGSGVKKAFGGGATGIFSNSHYIWKQFQSAGALTGDRVWRLPLWNYYRK------- 441
            ..::||:|||         .||.||.:..::       |..||....|........||       
Mouse   367 ADIIVDMATL---------TGAQGIATGKYH-------AAVLTNSAEWEAACVKAGRKCGDLVHP 415

  Fly   442 ----------QITDEMGYDLSN---DGRGLANSCLAAAVLHEL---VPCVDWAHLD--------T 482
                      :.|..:. |:.|   |.....:||....:...:   .|.| |.|||        .
Mouse   416 LVYCPELHFSEFTSAVA-DMKNSVADRDNSPSSCAGLFIASHIGFDWPGV-WVHLDIAAPVHAGE 478

  Fly   483 RGTG-----LLTKYG 492
            |.||     ||..:|
Mouse   479 RATGFGVALLLALFG 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S-Lap4NP_729613.1 PRK00913 31..514 CDD:234863 91/405 (22%)
Peptidase_M17 35..514 CDD:238247 91/405 (22%)
Npepl1NP_001365722.1 Peptidase_M17 35..492 CDD:238247 90/402 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.