DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S-Lap4 and lap-2

DIOPT Version :9

Sequence 1:NP_729613.1 Gene:S-Lap4 / 326188 FlyBaseID:FBgn0052064 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_506260.1 Gene:lap-2 / 179790 WormBaseID:WBGene00002250 Length:522 Species:Caenorhabditis elegans


Alignment Length:202 Identity:45/202 - (22%)
Similarity:76/202 - (37%) Gaps:44/202 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 LMEITYCGTNPEDKPILFLGKGITFNSGAMNLR-------KCRGMEEYRACMSGAASCVAMMRCV 319
            |:.:.|.|..........:|||:|.::|..:|:       .||  ::|     |:|......:.:
 Worm   251 LIRLEYVGEGETQDTFFVVGKGVTIDTGGCDLKTGGHMFGMCR--DKY-----GSAVVGGFFKAI 308

  Fly   320 AALALPINVCCIIPLC--ENMPSGMACKPGDVVTLMNHKSMAVRNLDKAGVVVMADPLLYGQ--- 379
            ..|. |.|:..:..:|  .|.....|....:|:|..:.|.:.:.|.|..|.:.|.|||...:   
 Worm   309 DVLK-PKNIKAVGYMCMVRNSIGSHAYTCDEVITSRSGKRIHIYNTDAEGRLTMLDPLTLAKEEA 372

  Fly   380 -STYKPRLVVDVATLGSGVKKAFGGGATG--IFSNSHYIWKQFQSAGALTGDRVWRLPLWNYYRK 441
             :...|.|.. ||||            ||  :.|..:|        .|:..:...:...|....:
 Worm   373 LNAKNPHLFT-VATL------------TGHEVLSYGYY--------AAIMDNGPAKASGWARRVQ 416

  Fly   442 QITDEMG 448
            .:.||.|
 Worm   417 NVGDEFG 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S-Lap4NP_729613.1 PRK00913 31..514 CDD:234863 45/202 (22%)
Peptidase_M17 35..514 CDD:238247 45/202 (22%)
lap-2NP_506260.1 Peptidase_M17 23..515 CDD:238247 45/202 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D562530at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.