DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb1 and si:ch211-71m22.5

DIOPT Version :9

Sequence 1:NP_648389.3 Gene:scramb1 / 326186 FlyBaseID:FBgn0052056 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_693207.5 Gene:si:ch211-71m22.5 / 564785 ZFINID:ZDB-GENE-130531-65 Length:277 Species:Danio rerio


Alignment Length:289 Identity:139/289 - (48%)
Similarity:176/289 - (60%) Gaps:27/289 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 GYPPGPAGPG----GPPNAFGGYPPGQPQQPIVTQPGMGPGMGPGMAPQGGPAGDWMSIPTGIP- 191
            |...|...||    .||....|:|||..:  :.|.|..|     .:|||         :|..:| 
Zfish     5 GQTEGVNAPGVNVPMPPVYTIGHPPGVNE--VYTTPPTG-----YVAPQ---------VPAVMPV 53

  Fly   192 -----NCPRGLEYLTTIDQLLVKQKVELLEAFTGFETNNKFTIKNALGQKVYFAAEDNDCCTRNC 251
                 .||.||||||.:|||||.|||||:|...|:||||::.:||:|||:|:||||::..|:|..
Zfish    54 LDRPMGCPVGLEYLTQVDQLLVHQKVELMEVLMGWETNNQYVVKNSLGQQVFFAAEESHFCSRMF 118

  Fly   252 CGPARPFDMRVFDNFQQEVIHMHRPLACSSCLFPCCLQSIEVSAPPGNVIGTIEQEWSICSPSFR 316
            ||..|.|.:.:.||..|||:.:.|||.||||.||||||.:||.:|.|:.:|.:.|.|....|.|.
Zfish   119 CGSVRSFLLHIQDNMGQEVMTLSRPLKCSSCFFPCCLQELEVHSPSGSPLGYVTQSWHPYLPKFI 183

  Fly   317 ILNHVGDTVMRIEGPFCTFSLCGDVEFNVVSL-TGEKIGKISKQWSGLAREIFTDADFFGINFPL 380
            |.|...:.|::|.||||....|.||.|.|:|| ....||:|||||||...|.|||||.||:.||:
Zfish   184 IHNERKEPVLKILGPFCDCKCCSDVNFEVMSLDESSVIGRISKQWSGFEAEAFTDADNFGLQFPM 248

  Fly   381 DLDVRMKAVLLGATFLIDAMFFEKAGNQE 409
            ||||::|||:|||.||||.||||....||
Zfish   249 DLDVKIKAVILGACFLIDFMFFEHTQKQE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb1NP_648389.3 Sox_C_TAD <61..>129 CDD:288887
Scramblase 184..404 CDD:252175 120/226 (53%)
si:ch211-71m22.5XP_693207.5 Scramblase 51..271 CDD:252175 118/219 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 288 1.000 Domainoid score I1533
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100156
Panther 1 1.100 - - O PTHR23248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.