DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb1 and PLSCR5

DIOPT Version :9

Sequence 1:NP_648389.3 Gene:scramb1 / 326186 FlyBaseID:FBgn0052056 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_016861862.1 Gene:PLSCR5 / 389158 HGNCID:19952 Length:300 Species:Homo sapiens


Alignment Length:254 Identity:113/254 - (44%)
Similarity:158/254 - (62%) Gaps:19/254 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 PGMGPGMAP---QGGPAGD------W-MSIP---TGIP--NCPRGLEYLTTIDQLLVKQKVELLE 216
            ||..|| ||   |..||..      | :|:|   :.:|  :.|.|||||:.:|.:::.|:||||.
Human    14 PGFLPG-APDPDQSLPASSNPGNQAWQLSLPLPSSFLPTVSLPPGLEYLSQLDLIIIHQQVELLG 77

  Fly   217 AFTGFETNNKFTIKNALGQKVYFAAEDNDCCTRNCCGPARPFDMRVFDNFQQEVIHMHRPLACSS 281
            ...|.||:||:.|||:|||::|||.|::.|..|..|...|...:|:.||..:|||.::|||.|:|
Human    78 MILGTETSNKYEIKNSLGQRIYFAVEESICFNRTFCSTLRSCTLRITDNSGREVITVNRPLRCNS 142

  Fly   282 CLFPCCLQSIEVSAPPGNVIGTIEQEWSICSPSFRILNHVGDTVMRIEGPFCTFSLCGDVEFNVV 346
            |..||.||.:|:.||||.::|.:.|:|....|.|.|.|...:.:::|.||..|....|||:|.|.
Human   143 CWCPCYLQELEIQAPPGTIVGYVTQKWDPFLPKFTIQNANKEDILKIVGPCVTCGCFGDVDFEVK 207

  Fly   347 SLTGEK--IGKISKQWSGLAREIFTDADFFGINFPLDLDVRMKAVLLGATFLIDAMFFE 403
            :: .||  ||||||.|||...::||:||.|||:.|.||||.:||.::||.||..:|.||
Human   208 TI-NEKLTIGKISKYWSGFVNDVFTNADNFGIHVPADLDVTVKAAMIGACFLFVSMGFE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb1NP_648389.3 Sox_C_TAD <61..>129 CDD:288887
Scramblase 184..404 CDD:252175 103/227 (45%)
PLSCR5XP_016861862.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 288 1.000 Domainoid score I1579
eggNOG 1 0.900 - - E1_KOG0621
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 1 1.000 - - mtm8657
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.