DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb1 and CG9084

DIOPT Version :9

Sequence 1:NP_648389.3 Gene:scramb1 / 326186 FlyBaseID:FBgn0052056 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001260884.1 Gene:CG9084 / 36172 FlyBaseID:FBgn0033582 Length:281 Species:Drosophila melanogaster


Alignment Length:277 Identity:74/277 - (26%)
Similarity:121/277 - (43%) Gaps:47/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 QQPIVTQPGMGPGMGPGMAPQGGPAGDWMSIPTGIPNCP----------RGLEYLTTIDQLLVKQ 210
            |||.:::|.:   ....::....|..:...||..:|...          .|.:.|..:..:.::|
  Fly    20 QQPSLSEPRV---YDSHISITSQPRPEAPRIPLPVPIATVTGSRTLIPLSGYDCLADLPSVHIEQ 81

  Fly   211 KVEL------LEAFTGFETNNKFTIKNALGQKVYFAAEDNDCCTRNCCGPARPFDMRVFDNFQQE 269
            ..||      ..|.||..:.|::.:::.||..::.|.|.:....|...|..|||.|.:.|...||
  Fly    82 TFELNDVRLPFAALTGVSSENRYVVRSPLGDAIFAANESSTEKNRLLWGAGRPFQMHLLDKTHQE 146

  Fly   270 VIHMHRPLACSSCLFPCC-LQSIEVSAPPGNVIGTIEQEWSICSPSFRILNH-VGDTVMRIEGP- 331
            .:...:.||..|.   || .:|:|:..||||::|.:.|..:...|.|.|.:. .|.....:||| 
  Fly   147 ALVFRKKLAMGSM---CCQAKSLEIWIPPGNLLGKVVQSPTFMQPEFFIEDESTGQLTFCVEGPV 208

  Fly   332 ---FCTFSLCGDVEFNVVSLTGEKIGKISKQWSGLARE-------IFTDADFFGINFPLDLDVRM 386
               ||.|||..|..|.:.| .|.....|..:|  ||.:       .|:||         .|..:.
  Fly   209 GLGFCCFSLPKDCYFKIHS-GGNMRASIDHKW--LASKSQYTTNIYFSDA---------KLTAKE 261

  Fly   387 KAVLLGATFLIDAMFFE 403
            :|::||:.||::.:||:
  Fly   262 RALILGSAFLLEYLFFQ 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb1NP_648389.3 Sox_C_TAD <61..>129 CDD:288887
Scramblase 184..404 CDD:252175 69/249 (28%)
CG9084NP_001260884.1 LOR 66..277 CDD:295149 64/225 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I3943
eggNOG 1 0.900 - - E1_KOG0621
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I1798
Isobase 1 0.950 - 0 Normalized mean entropy S1940
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.