DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb1 and scrm-7

DIOPT Version :9

Sequence 1:NP_648389.3 Gene:scramb1 / 326186 FlyBaseID:FBgn0052056 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_506646.1 Gene:scrm-7 / 190110 WormBaseID:WBGene00013052 Length:293 Species:Caenorhabditis elegans


Alignment Length:264 Identity:71/264 - (26%)
Similarity:115/264 - (43%) Gaps:28/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 GGYPPGQPQQPIVTQPGMGPGMGPGMAPQGGPAGDWMSIPTGIPNCP--RGLEYLTTIDQLLVKQ 210
            ||:.|.....|||. |.....|...|              ||..|.|  ..|:.::..:.::|.|
 Worm    24 GGHMPQVRSTPIVL-PNQVASMPVRM--------------TGFNNLPAHNVLDMISRTNSMMVVQ 73

  Fly   211 KVELLEAFTGFETNNKFTIKNALGQKVYFAAEDNDCCTRNCCGPARPFDMRVFDNFQQEVIHMHR 275
            .:|.||..||.||.|::.:.:...:.:....|.::...|...|..|.|.|...|.|...|:..||
 Worm    74 ALEPLEIATGIETPNQYVVHDMYCRPIMNCMERSNGFARQMQGSHRSFAMMCTDLFGAHVMQCHR 138

  Fly   276 PLACSSCLFPCCLQSIEVSAPPGNVIGTIEQEWSICSPSFRILNHVGDTVMRIEGPFCTFSLCGD 340
            .....|.......|.:      |..||.:.:...  ..:|.:|....:..:.|..|.  |:..|.
 Worm   139 DQPWGSFTDHLTTQFL------GQNIGIMSRTHG--DVNFHLLGAGSNQSLLIRSPL--FAASGG 193

  Fly   341 V-EFNVVSLTGEKIGKISKQWSGLAREIFTDADFFGINFPLDLDVRMKAVLLGATFLIDAMFFEK 404
            . .|.|::..|.::|:|.:.:.|..:|:::|||.:.::||:||...:|.:|:.:.||||..|||.
 Worm   194 TRSFPVMTYNGMRVGEIVRLYPGYMQEMYSDADTYIVHFPMDLPPILKLLLISSVFLIDFTFFEN 258

  Fly   405 AGNQ 408
            .|.|
 Worm   259 NGQQ 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb1NP_648389.3 Sox_C_TAD <61..>129 CDD:288887
Scramblase 184..404 CDD:252175 59/222 (27%)
scrm-7NP_506646.1 Scramblase 48..258 CDD:252175 60/233 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165972
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X164
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.