DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb1 and scrm-1

DIOPT Version :9

Sequence 1:NP_648389.3 Gene:scramb1 / 326186 FlyBaseID:FBgn0052056 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_492976.2 Gene:scrm-1 / 173053 WormBaseID:WBGene00011935 Length:295 Species:Caenorhabditis elegans


Alignment Length:280 Identity:116/280 - (41%)
Similarity:157/280 - (56%) Gaps:32/280 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 QQPIVT-QPGMGP-GMG-------------------PGMAPQGGPAGDWMSIPTGIPNCPRGLEY 199
            |||::. |||..| ||.                   ||:..|..|...||.:|..|...|.||||
 Worm     2 QQPVINQQPGYNPQGMNPVQQFEMHQQQHQQAITTQPGVFVQPAPGSVWMPMPPAIQGVPTGLEY 66

  Fly   200 LTTIDQLLVKQKVELLEAFTGFETNNKFTIKNALGQKVYFAAEDNDCCTRNCCGPARPFDMRVFD 264
            ||.:|.::|.|..||:|..|.:||.||:.:|||.|::.|:|.|::.||.|.||||.|.|.|.:.|
 Worm    67 LTYLDTIMVHQIKELIEIVTDWETKNKYVLKNANGEQCYYAFEESGCCERQCCGPQRGFVMHIVD 131

  Fly   265 NFQQEVIHMHRPL-----ACSSCL--FPCCLQSIEVSAPPGNVIGTIEQEWSICSPSFRILNHVG 322
            ||::||:.:.|..     .|..||  ..||.|...:..|...|:|.|.|.....|.::.|::..|
 Worm   132 NFKREVLTIKREFKCCGGGCCGCLACIGCCQQECIIETPSMGVLGIIRQRCGCMSSNYDIMDGDG 196

  Fly   323 DTVMRIEGPFCTFSLCG--DVEFNV-VSLTGEKIGKISKQWSGLAREIFTDADFFGINFPLDLDV 384
            :.:.:|:||.|.. |||  |.||.: .:..|..:|.|:|:|.|..||.|||||.|.:|||.||||
 Worm   197 NVIFQIDGPCCCM-LCGCQDKEFPIKTANNGTVVGAITKKWGGCFREAFTDADTFAVNFPGDLDV 260

  Fly   385 RMKAVLLGATFLIDAMFFEK 404
            ::|.||:|||||||.|.||:
 Worm   261 KLKGVLIGATFLIDFMEFEQ 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb1NP_648389.3 Sox_C_TAD <61..>129 CDD:288887
Scramblase 184..404 CDD:252175 101/229 (44%)
scrm-1NP_492976.2 Scramblase 51..280 CDD:252175 101/229 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 193 1.000 Domainoid score I1864
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41418
Inparanoid 1 1.050 208 1.000 Inparanoid score I2390
Isobase 1 0.950 - 0 Normalized mean entropy S1940
OMA 1 1.010 - - QHG28609
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 1 1.000 - - mtm4812
orthoMCL 1 0.900 - - OOG6_100156
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1891
SonicParanoid 1 1.000 - - X164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.