DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb1 and LOC100536708

DIOPT Version :9

Sequence 1:NP_648389.3 Gene:scramb1 / 326186 FlyBaseID:FBgn0052056 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_003197974.1 Gene:LOC100536708 / 100536708 -ID:- Length:273 Species:Danio rerio


Alignment Length:244 Identity:74/244 - (30%)
Similarity:114/244 - (46%) Gaps:25/244 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 PAGDWMSIPTGIPNCPRG-----------------LEYLTTIDQLLVKQKVELLEAFTGFE--TN 224
            ||||...:...:.:  ||                 |..|.|:.:|.:..:.||    .|.:  ..
Zfish    34 PAGDTQDLTLVLQD--RGDHEGPANTHTESKTLGKLTALRTVTRLHITARPEL----QGPQCVAR 92

  Fly   225 NKFTIKNALGQKVYFAAEDNDCCTRNCCGPARPFDMRVFDNFQQEVIHMHRPLACSSCLFPCCLQ 289
            ..::|.:....:::.|.|::.|....||||||...:|.||...:.|....|||....|...|||.
Zfish    93 RTYSICSENRDQLFVAVEESSCMCMQCCGPARSCSLRGFDKDSECVFLFERPLRADMCCLGCCLM 157

  Fly   290 SIEVSAPPGNVIGTIEQEWSICSPSFRILNHVGDTVMRIEGPFCTFSLCGDVEFNVVSLTGEKIG 354
            .|........:|||:.|.||:.:|...:.:..|.:.|||:|..|......:.|..|||..||.||
Zfish   158 EIRAYTAERELIGTVHQRWSMFTPYLEVCDSEGISAMRIQGSCCNTRCLSEQELQVVSTIGESIG 222

  Fly   355 KISKQWSGLAREIFTDADFFGINFPLDLDVRMKAVLLGATFLIDAMFFE 403
            :|.|:|.|...:...|.::||::.|.::.:..|.:||.|.||::.||||
Zfish   223 RIWKKWPGYNDKCNMDHEYFGLDVPQEMSLNTKVLLLAAAFLLNHMFFE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb1NP_648389.3 Sox_C_TAD <61..>129 CDD:288887
Scramblase 184..404 CDD:252175 70/239 (29%)
LOC100536708XP_003197974.1 LOR 95..271 CDD:295149 59/175 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.